SAXSdb — 3cka

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Outer surface protein A

Borreliella burgdorferi

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Homooligomer	Protein 2	PENTAETHYLENE GLYCOL × 7 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D2Y4L7_BORBG
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 5–119； UniProt 27–141 Author chain B； PDBConstruct 5–119； UniProt 27–141

Outer surface protein A

Borreliella burgdorferi

UniProt Q45040

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Homooligomer	Protein 2	PENTAETHYLENE GLYCOL × 7 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q45040_BORBG
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 189–320； UniProt 142–273 Author chain B； PDBConstruct 189–320； UniProt 142–273

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3cka
Deposition date deposition_date	2008-03-14
Structure title title	The crystal structure of OspA mutant
Keywords keywords	beta-sheet, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3cka__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3cka__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3cka__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	34.64 Å
Rg (electron density)	34.09 Å
Total Rg	34.51 Å
Atom count	4887
Residues	631
Excluded volume	87355 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3cka__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Outer surface protein A
Molecular weight formula_weight	34692.6 kDa
Mutation mutation	;E37S,E45S,K46S,K48A,K60A,K64S,K83A,E104S,K107S,E123Y,K125L,V132L,E134F,I136Y,K308S,E309S,K323S,E37S,E45S,K46S,K48A,K60A,K64S,K83A,E104S,K107S,E123Y,K125L,V132L,E134F,I136Y,K308S,E309S,K323S,E37S,E45S,K46S,K48A,K60A,K64S,K83A,E104S,K107S,E123Y,K125L,V132L,E134F,I136Y,K308S,E309S,K323S ;
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	5459

GSHMKNSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVSKKVTSKDKSSTYELFNEKGELSFKYITRADKSSTYELFNEKGELSFKYITRADKSSTYELFNEKGELSFKYITRADKSSTYELFNEKGELSFKYITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIKNALK

Source Source

Source organism organism	Borreliella burgdorferi
Common name common_name	Lyme disease spirochete
NCBI taxonomy ID ncbi_taxonomy_id	139
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	PENTAETHYLENE GLYCOL
Molecular weight formula_weight	238.3 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	517

▶

Unit-cell length a length_a	75.293 Å
Unit-cell length b length_b	83.647 Å
Unit-cell length c length_c	106.153 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.650 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.2041
R_work r_work	0.2021
R_free r_free	0.2403

The crystal structure of OspA mutant

1. Protein Identity and Related Structures Protein Identity & Related Structures

Outer surface protein A

State in the Current Structure

Other States of the Same Protein in the Database

Outer surface protein A

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3cka__assembly_1__model_1

3cka__assembly_1__model_1 | I(q)

3cka__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

7. Citations (1)

The crystal structure of OspA mutant

1. Protein Identity and Related Structures Protein Identity & Related Structures

Outer surface protein A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Outer surface protein A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3cka__assembly_1__model_1

3cka__assembly_1__model_1 | I(q)

3cka__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

7. Citations (1)