SAXSdb — 3ctw

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

RcdA

Caulobacter vibrioides

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	1,2-ETHANEDIOL × 8 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9A3A9_CAUCR
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 1–169； UniProt 1–169 Author chain D； PDBConstruct 1–169； UniProt 1–169

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3ctw
Deposition date deposition_date	2008-04-14
Structure title title	Crystal Structure of RcdA from Caulobacter crescentus CB15
Keywords keywords	PROTEIN BINDING; PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3ctw__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3ctw__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3ctw__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	20.91 Å
Rg (electron density)	20.02 Å
Total Rg	20.82 Å
Atom count	1898
Residues	239
Excluded volume	33521 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3ctw__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	RcdA
Molecular weight formula_weight	19054.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D
Atom count atom_count	1904

MTEVNAFADTPWRAGVIQDFARSELFDRTFEEGMQLVEETAAYLDGAGRHDSKVLSRNAALGYATESMRLTTRLMQVASWLLVQRAVREGEMPPEAACAEAYRLAEEAPADGPAVEELPFGLMNLLQRSERLYERVRHLDRRMYVESPNEEAPRPVQNQLDRLTAAFGG

Source Source

Source organism organism	Caulobacter vibrioides
NCBI taxonomy ID ncbi_taxonomy_id	155892
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	6

▼

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	3ctwB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	8 — Helicase, Ruva Protein; domain 3
Homologous superfamily homologous superfamily	930 — Protein of unknown function DUF1465

Domain ID domain_id	3ctwD00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	8 — Helicase, Ruva Protein; domain 3
Homologous superfamily homologous superfamily	930 — Protein of unknown function DUF1465

▶

Unit-cell length a length_a	75.458 Å
Unit-cell length b length_b	75.458 Å
Unit-cell length c length_c	81.419 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 43
Space-group number int_tables_number	78
Crystal system crystal_system	—

Resolution resolution	2.900 Å
Low-resolution limit resolution_low	44.630 Å
R factor r_factor	0.2760
R_work r_work	0.2740
R_free r_free	0.3120

Crystal Structure of RcdA from Caulobacter crescentus CB15

1. Protein Identity and Related Structures Protein Identity & Related Structures

RcdA

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3ctw__assembly_1__model_1

3ctw__assembly_1__model_1 | I(q)

3ctw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)

Crystal Structure of RcdA from Caulobacter crescentus CB15

1. Protein Identity and Related Structures Protein Identity & Related Structures

RcdA

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3ctw__assembly_1__model_1

3ctw__assembly_1__model_1 | I(q)

3ctw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)