SAXSdb — 3d2s

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Muscleblind-like protein 1

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Monomer	Protein 1 RNA 3	5'-R(CPGPCPUPGPU)-3' × 3 ZINC ION × 2 water × 4	Consistent with all polymers
2	Protein–RNA	Monomer	Protein 1 RNA 1	5'-R(CPGPCPUPGPU)-3' × 1 ZINC ION × 2 water × 2	Consistent with all polymers
3	Protein–RNA	Monomer	Protein 1 RNA 3	5'-R(CPGPCPUPGPU)-3' × 3 ZINC ION × 2 water × 4	Consistent with all polymers
4	Protein–RNA	Monomer	Protein 1 RNA 1	5'-R(CPGPCPUPGPU)-3' × 1 ZINC ION × 2 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MBNL1_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 2–70； UniProt 178–246 Author chain B； PDBConstruct 2–70； UniProt 178–246 Author chain C； PDBConstruct 2–70； UniProt 178–246 Author chain D； PDBConstruct 2–70； UniProt 178–246

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3d2s
Deposition date deposition_date	2008-05-08
Structure title title	Crystal structure of MBNL1 tandem zinc finger 3 and 4 domain in complex with CGCUGU RNA
Keywords keywords	tandem zinc finger domain, RNA, Metal-binding, Nucleus, RNA-binding, Zinc-finger, METAL BINDING PROTEIN-RNA COMPLEX; METAL BINDING PROTEIN/RNA
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3d2s__assembly_3__model_1

Assembly 3 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3d2s__assembly_3__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3d2s__assembly_3__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	17.21 Å
Rg (electron density)	15.74 Å
Total Rg	16.59 Å
Atom count	830
Residues	84
Excluded volume	13426 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3d2s__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3d2s__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`3d2s__assembly_3__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`3d2s__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	5'-R(CPGPCPUPGPU)-3'
Molecular weight formula_weight	1868.1 kDa
Source method src_method	syn
Copy count entity_count	4

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	E,F,G,H
Atom count atom_count	2954

CGCUGU

Entity 2 Entity 2 polymer

Description description	Muscleblind-like protein 1
Molecular weight formula_weight	8169.2 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D

SRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	402

▼

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	3d2sA00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1370 — Ribosomal Protein S8; Chain: A, domain 1
Homologous superfamily homologous superfamily	210 —

Domain ID domain_id	3d2sB00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1370 — Ribosomal Protein S8; Chain: A, domain 1
Homologous superfamily homologous superfamily	210 —

Domain ID domain_id	3d2sC00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1370 — Ribosomal Protein S8; Chain: A, domain 1
Homologous superfamily homologous superfamily	210 —

Domain ID domain_id	3d2sD00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1370 — Ribosomal Protein S8; Chain: A, domain 1
Homologous superfamily homologous superfamily	210 —

▶

Unit-cell length a length_a	56.421 Å
Unit-cell length b length_b	56.899 Å
Unit-cell length c length_c	58.222 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	108.81 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.700 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.2263
R_work r_work	0.2245
R_free r_free	0.2598

Crystal structure of MBNL1 tandem zinc finger 3 and 4 domain in complex with CGCUGU RNA

1. Protein Identity and Related Structures Protein Identity & Related Structures

Muscleblind-like protein 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3d2s__assembly_3__model_1

3d2s__assembly_3__model_1 | I(q)

3d2s__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)

Crystal structure of MBNL1 tandem zinc finger 3 and 4 domain in complex with CGCUGU RNA

1. Protein Identity and Related Structures Protein Identity & Related Structures

Muscleblind-like protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3d2s__assembly_3__model_1

3d2s__assembly_3__model_1 | I(q)

3d2s__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)