SAXSdb — 3d37

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tail protein, 43 kDa

Neisseria meningitidis MC58

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 6	CHLORIDE ION × 18 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9JZC8_NEIMB
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–381； UniProt 1–381 Author chain B； PDBConstruct 1–381； UniProt 1–381

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3d37
Deposition date deposition_date	2008-05-09
Structure title title	The crystal structure of the tail protein from Neisseria meningitidis MC58
Keywords keywords	;tail protein, structural genomics, PSI, MCSG, Protein Structure Initiative, Midwest Center for Structural Genomics, UNKNOWN FUNCTION ;; STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3d37__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3d37__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3d37__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	41.33 Å
Rg (electron density)	41.34 Å
Total Rg	41.73 Å
Atom count	15105
Residues	1926
Excluded volume	268100 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3d37__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Tail protein, 43 kDa
Molecular weight formula_weight	42126.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	5398

MQNNSYGYAVSVRVGGKEHRHWERYDIDSDFLIPADSFDFVIGRLGPEAAIPDLSGESCEVVIDGQIVMTGIIGSQRHGKSKGSRELSLSGRDLAGFLVDCSAPQLNVKGMTVLDAAKKLAAPWPQIKAVVLKAENNPALGKIDIEPGETVWQALTHIANSVGLHPWLEPDGTLVVGGADYSSPPVATLCWSRTDSRCNIERMDIEWDTDNRFSEVTFLAQSHGRSGDSAKHDLKWVYKDPTMTLHRPKTVVVSDADNLAALQKQAKKQLADWRLEGFTLTITVGGHKTRDGVLWQPGLRVHVIDDEHGIDAVFFLMGRRFMLSRMDGTQTELRLKEDGIWTPDAYPKKAEAARKRKGKRKGVSHKGKKGGKKQAETAVFE

Source Source

Source organism organism	Neisseria meningitidis MC58
NCBI taxonomy ID ncbi_taxonomy_id	122586
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	363

▼

6. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d3d37a1
Class class	b — All beta proteins
Fold Fold fold	b.106 — Phage tail proteins
Superfamily Superfamily superfamily	b.106.1 — Phage tail proteins
Family Family family	b.106.1.1 — Baseplate protein-like

Domain ID domain_id	d3d37a2
Class class	b — All beta proteins
Fold Fold fold	b.106 — Phage tail proteins
Superfamily Superfamily superfamily	b.106.1 — Phage tail proteins
Family Family family	b.106.1.1 — Baseplate protein-like

Domain ID domain_id	d3d37b1
Class class	b — All beta proteins
Fold Fold fold	b.106 — Phage tail proteins
Superfamily Superfamily superfamily	b.106.1 — Phage tail proteins
Family Family family	b.106.1.1 — Baseplate protein-like

Domain ID domain_id	d3d37b2
Class class	b — All beta proteins
Fold Fold fold	b.106 — Phage tail proteins
Superfamily Superfamily superfamily	b.106.1 — Phage tail proteins
Family Family family	b.106.1.1 — Baseplate protein-like

CATH v4.4 (6 domains)

Domain ID domain_id	3d37A01
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	300 — Phage tail proteins - horseshoe like beta roll fold
Homologous superfamily homologous superfamily	10 — Baseplate protein-like domain - beta roll fold

Domain ID domain_id	3d37A02
Class class	3 — Alpha Beta
Architecture architecture	55 — 3-Layer(bab) Sandwich
Topology topology	50 — Phage tail protein beta-alpha-beta fold
Homologous superfamily homologous superfamily	10 — Baseplate protein-like domains

Domain ID domain_id	3d37A03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1920 — Phage tail proteins - 2 layer sandwich fold
Homologous superfamily homologous superfamily	10 — Baseplate protein-like domains - 2 layer sandwich fold

Domain ID domain_id	3d37B01
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	300 — Phage tail proteins - horseshoe like beta roll fold
Homologous superfamily homologous superfamily	10 — Baseplate protein-like domain - beta roll fold

Domain ID domain_id	3d37B02
Class class	3 — Alpha Beta
Architecture architecture	55 — 3-Layer(bab) Sandwich
Topology topology	50 — Phage tail protein beta-alpha-beta fold
Homologous superfamily homologous superfamily	10 — Baseplate protein-like domains

Domain ID domain_id	3d37B03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1920 — Phage tail proteins - 2 layer sandwich fold
Homologous superfamily homologous superfamily	10 — Baseplate protein-like domains - 2 layer sandwich fold

▶

Unit-cell length a length_a	137.460 Å
Unit-cell length b length_b	137.460 Å
Unit-cell length c length_c	137.460 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 21 3
Space-group number int_tables_number	198
Crystal system crystal_system	—

Resolution resolution	2.100 Å
Low-resolution limit resolution_low	97.130 Å
R factor r_factor	0.2222
R_work r_work	0.2195
R_free r_free	0.2735

The crystal structure of the tail protein from Neisseria meningitidis MC58

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tail protein, 43 kDa

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3d37__assembly_1__model_1

3d37__assembly_1__model_1 | I(q)

3d37__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (4 domains)

CATH v4.4 (6 domains)

7. Citations (1)

The crystal structure of the tail protein from Neisseria meningitidis MC58

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tail protein, 43 kDa

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3d37__assembly_1__model_1

3d37__assembly_1__model_1 | I(q)

3d37__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (4 domains)

CATH v4.4 (6 domains)

7. Citations (1)