3dby

Crystal structure of uncharacterized protein from Bacillus cereus G9241 (CSAP Target)

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

uncharacterized protein

Bacillus cereus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 6	FE (III) ION × 12 1,2-ETHANEDIOL × 3 water × 6	Consistent with protein count
10	Protein homooligomer	Homooligomer	Protein 6	FE (III) ION × 12 water × 6	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 6	FE (III) ION × 12 water × 6	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 6	FE (III) ION × 12 water × 6	Consistent with protein count
4	Protein homooligomer	Homooligomer	Protein 6	FE (III) ION × 12 water × 6	Consistent with protein count
5	Protein homooligomer	Homooligomer	Protein 6	FE (III) ION × 12 water × 6	Consistent with protein count
6	Protein homooligomer	Homooligomer	Protein 6	FE (III) ION × 12 1,2-ETHANEDIOL × 3 water × 6	Consistent with protein count
7	Protein homooligomer	Homooligomer	Protein 6	FE (III) ION × 12 water × 6	Consistent with protein count
8	Protein homooligomer	Homooligomer	Protein 6	FE (III) ION × 12 water × 6	Consistent with protein count
9	Protein homooligomer	Homooligomer	Protein 6	FE (III) ION × 12 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q4MWP8_BACCE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–261； UniProt 1–259 Author chain B； PDBConstruct 1–261； UniProt 1–259 Author chain C； PDBConstruct 1–261； UniProt 1–259 Author chain D； PDBConstruct 1–261； UniProt 1–259 Author chain E； PDBConstruct 1–261； UniProt 1–259 Author chain F； PDBConstruct 1–261； UniProt 1–259 Author chain G； PDBConstruct 1–261； UniProt 1–259 Author chain H； PDBConstruct 1–261； UniProt 1–259 Author chain I； PDBConstruct 1–261； UniProt 1–259 Author chain J； PDBConstruct 1–261； UniProt 1–259 Author chain K； PDBConstruct 1–261； UniProt 1–259 Author chain L； PDBConstruct 1–261； UniProt 1–259 Author chain M； PDBConstruct 1–261； UniProt 1–259 Author chain N； PDBConstruct 1–261； UniProt 1–259 Author chain O； PDBConstruct 1–261； UniProt 1–259 Author chain P； PDBConstruct 1–261； UniProt 1–259 Author chain Q； PDBConstruct 1–261； UniProt 1–259 Author chain R； PDBConstruct 1–261； UniProt 1–259 Author chain S； PDBConstruct 1–261； UniProt 1–259 Author chain T； PDBConstruct 1–261； UniProt 1–259

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3dby
Deposition date deposition_date	2008-06-02
Structure title title	Crystal structure of uncharacterized protein from Bacillus cereus G9241 (CSAP Target)
Keywords keywords	;structural genomics, UNKNOWN FUNCTION, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC ;; structural genomics, unknown function
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3dby__assembly_9__model_1

Assembly 9 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3dby__assembly_9__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3dby__assembly_9__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	37.00 Å
Rg (electron density)	36.25 Å
Total Rg	36.80 Å
Atom count	12921
Residues	1569
Excluded volume	231890 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3dby__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3dby__assembly_2__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`3dby__assembly_3__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`3dby__assembly_4__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`3dby__assembly_5__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`3dby__assembly_6__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
7	1	`3dby__assembly_7__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
8	1	`3dby__assembly_8__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
9	1	`3dby__assembly_9__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
10	1	`3dby__assembly_10__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	uncharacterized protein
Molecular weight formula_weight	31418.1 kDa
Source method src_method	man
Copy count entity_count	20

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T
Atom count atom_count	45580

MSLERNYEESALFEHQFWLKVLTDHAQFLLDALAPKEKEDIKKATYFVETFTNLLNKVRNVNLMAFSKEAEQAAKEIRAFKLNIIQKQLEGKITIHFTPTFINHMVNEVEEYIAVLEFLKKGEVPPVFHELHYHLVWLTDAAGHAGSISGGLDLVEKRLKEKSEEFTKHFEQFYLKAVEMTGYLRTELHHFPALKKFTKDVSLELKLFSHFLHEVEELELSNEVLSVLSARMADHMAREECYYLLKLAQSSGLEMPKCNPLEGHHHHHH

Source Source

Source organism organism	Bacillus cereus
NCBI taxonomy ID ncbi_taxonomy_id	269801
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	FE (III) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	40

Entity 3 Entity 3 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	2073

▼

6. Fold Classification (SCOP + CATH) 85 domains

SCOP 2.08 (65 domains)

Domain ID domain_id	d3dbya1
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbya2
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbya3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3dbyb1
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyb2
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyb3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3dbyb4
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3dbyc1
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyc2
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyc3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3dbyc4
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3dbyd1
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyd2
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyd3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3dbye1
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbye2
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbye3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3dbyf1
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyf2
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyf3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3dbyf4
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3dbyg1
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyg2
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyg3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3dbyh1
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyh2
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyh3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3dbyh4
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3dbyi1
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyi2
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyi3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3dbyj1
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyj2
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyj3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3dbyk1
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyk2
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyk3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3dbyl1
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyl2
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyl3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3dbym1
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbym2
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbym3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3dbyn1
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyn2
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyn3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3dbyo1
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyo2
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyo3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3dbyp1
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyp2
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyp3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3dbyq1
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyq2
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyq3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3dbyr1
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyr2
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyr3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3dbys1
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbys2
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbys3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3dbyt1
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyt2
Class class	a — All alpha proteins
Fold Fold fold	a.29 — Bromodomain-like
Superfamily Superfamily superfamily	a.29.13 — Bacillus cereus metalloprotein-like
Family Family family	a.29.13.1 — Bacillus cereus metalloprotein-like

Domain ID domain_id	d3dbyt3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3dbyt4
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (20 domains)

Domain ID domain_id	3dbyA00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	120 — Protein of unknown function DUF2935

Domain ID domain_id	3dbyB00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	120 — Protein of unknown function DUF2935

Domain ID domain_id	3dbyC00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	120 — Protein of unknown function DUF2935

Domain ID domain_id	3dbyD00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	120 — Protein of unknown function DUF2935

Domain ID domain_id	3dbyE00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	120 — Protein of unknown function DUF2935

Domain ID domain_id	3dbyF00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	120 — Protein of unknown function DUF2935

Domain ID domain_id	3dbyG00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	120 — Protein of unknown function DUF2935

Domain ID domain_id	3dbyH00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	120 — Protein of unknown function DUF2935

Domain ID domain_id	3dbyI00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	120 — Protein of unknown function DUF2935

Domain ID domain_id	3dbyJ00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	120 — Protein of unknown function DUF2935

Domain ID domain_id	3dbyK00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	120 — Protein of unknown function DUF2935

Domain ID domain_id	3dbyL00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	120 — Protein of unknown function DUF2935

Domain ID domain_id	3dbyM00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	120 — Protein of unknown function DUF2935

Domain ID domain_id	3dbyN00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	120 — Protein of unknown function DUF2935

Domain ID domain_id	3dbyO00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	120 — Protein of unknown function DUF2935

Domain ID domain_id	3dbyP00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	120 — Protein of unknown function DUF2935

Domain ID domain_id	3dbyQ00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	120 — Protein of unknown function DUF2935

Domain ID domain_id	3dbyR00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	120 — Protein of unknown function DUF2935

Domain ID domain_id	3dbyS00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	120 — Protein of unknown function DUF2935

Domain ID domain_id	3dbyT00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	120 — Protein of unknown function DUF2935

▶

Unit-cell length a length_a	167.808 Å
Unit-cell length b length_b	167.808 Å
Unit-cell length c length_c	582.661 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	180

Space group space_group	H 3
Space-group number int_tables_number	146
Crystal system crystal_system	—

Resolution resolution	2.100 Å
Low-resolution limit resolution_low	50.000 Å
R factor r_factor	0.2010
R_work r_work	0.1980
R_free r_free	0.2580

Crystal structure of uncharacterized protein from Bacillus cereus G9241 (CSAP Target)

1. Protein Identity and Related Structures Protein Identity & Related Structures

uncharacterized protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3dby__assembly_9__model_1

3dby__assembly_9__model_1 | I(q)

3dby__assembly_9__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 85 domains

SCOP 2.08 (65 domains)

CATH v4.4 (20 domains)

7. Citations (1)

Crystal structure of uncharacterized protein from Bacillus cereus G9241 (CSAP Target)

1. Protein Identity and Related Structures Protein Identity & Related Structures

uncharacterized protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3dby__assembly_9__model_1

3dby__assembly_9__model_1 | I(q)

3dby__assembly_9__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 85 domains

SCOP 2.08 (65 domains)

CATH v4.4 (20 domains)

7. Citations (1)