SAXSdb — 3elg

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

uncharacterized periplasmic protein

Bacteroides vulgatus ATCC 8482

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	CITRIC ACID × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A6L337_BACV8
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–128； UniProt 20–146 Author chain B； PDBConstruct 2–128； UniProt 20–146

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3elg
Deposition date deposition_date	2008-09-22
Structure title title	Crystal structure of a putative periplasmic protein of unknown function (bvu_2443) from bacteroides vulgatus atcc 8482 at 1.64 A resolution
Keywords keywords	;Blip-like fold, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, membrane protein ;; MEMBRANE PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3elg__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3elg__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3elg__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	16.02 Å
Rg (electron density)	15.04 Å
Total Rg	16.08 Å
Atom count	1010
Residues	124
Excluded volume	18028 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3elg__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3elg__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	uncharacterized periplasmic protein
Molecular weight formula_weight	14596.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	2589

GAGDVVTRDVNKLPVAAREMIGKHFSQTKVAYIKIEKDLFQTTSYDVKLADGIELEFNSKGEWLEIDCKNKSVPSTFIPQAISKYMKANYNGHKTVKIERNRKGYELTLENGLEVDFDQFGGFLKLSD

Source Source

Source organism organism	Bacteroides vulgatus ATCC 8482
NCBI taxonomy ID ncbi_taxonomy_id	435590
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	CITRIC ACID
Molecular weight formula_weight	192.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	338

▼

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d3elga1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.98 — BLIP-like
Superfamily Superfamily superfamily	d.98.2 — BT0923-like
Family Family family	d.98.2.1 — BT0923-like

Domain ID domain_id	d3elgb_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.98 — BLIP-like
Superfamily Superfamily superfamily	d.98.2 — BT0923-like
Family Family family	d.98.2.1 — BT0923-like

CATH v4.4 (2 domains)

Domain ID domain_id	3elgA00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1420 — Inhibitor of vertebrate lysozyme, Ivy
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	3elgB00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1420 — Inhibitor of vertebrate lysozyme, Ivy
Homologous superfamily homologous superfamily	30 —

▶

Unit-cell length a length_a	40.242 Å
Unit-cell length b length_b	73.507 Å
Unit-cell length c length_c	53.544 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	108.36 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.640 Å
Low-resolution limit resolution_low	29.775 Å
R factor r_factor	0.1740
R_work r_work	0.1720
R_free r_free	0.2090

Crystal structure of a putative periplasmic protein of unknown function (bvu_2443) from bacteroides vulgatus atcc 8482 at 1.64 A resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

uncharacterized periplasmic protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3elg__assembly_2__model_1

3elg__assembly_2__model_1 | I(q)

3elg__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)

Crystal structure of a putative periplasmic protein of unknown function (bvu_2443) from bacteroides vulgatus atcc 8482 at 1.64 A resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

uncharacterized periplasmic protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3elg__assembly_2__model_1

3elg__assembly_2__model_1 | I(q)

3elg__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)