SAXSdb — 3f85

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

homo trimeric fusion of CFA/I fimbrial subunits B

Escherichia coli

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	MAGNESIUM ION × 4 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FMC1_ECOLX
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–134； UniProt 38–170 Author chain A； PDBConstruct 139–285； UniProt 24–170 Author chain A； PDBConstruct 290–436； UniProt 24–170 Author chain A； PDBConstruct 441–455； UniProt 24–38

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3f85
Deposition date deposition_date	2008-11-11
Structure title title	Structure of fusion complex of homo trimeric major pilin subunits CfaB of CFA/I fimbirae from ETEC E. coli
Keywords keywords	ETEC, CfaBBB, major pilin, pilus, pili, fimbriae, CFA/I, Cell projection, Fimbrium, CELL ADHESION; CELL ADHESION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3f85__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3f85__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3f85__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	42.31 Å
Rg (electron density)	43.69 Å
Total Rg	43.28 Å
Atom count	3292
Residues	456
Excluded volume	58814 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3f85__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	homo trimeric fusion of CFA/I fimbrial subunits B
Molecular weight formula_weight	47990.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	3400

MIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGSDNKQVEKNITVTASVDPVIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGSDNKQVEKNITVTASVDPVIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGSDNKQVEKNITVTASVDPVILEHHHHHH

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	108

▼

6. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

Domain ID domain_id	3f85A01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	2040 — CFA/I fimbrial subunit E, pilin domain

Domain ID domain_id	3f85A02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	2040 — CFA/I fimbrial subunit E, pilin domain

Domain ID domain_id	3f85A03
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	2040 — CFA/I fimbrial subunit E, pilin domain

▶

Unit-cell length a length_a	127.406 Å
Unit-cell length b length_b	44.982 Å
Unit-cell length c length_c	97.880 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	125.35 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	2.100 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.2358
R_work r_work	0.2330
R_free r_free	0.2830

Structure of fusion complex of homo trimeric major pilin subunits CfaB of CFA/I fimbirae from ETEC E. coli

1. Protein Identity and Related Structures Protein Identity & Related Structures

homo trimeric fusion of CFA/I fimbrial subunits B

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3f85__assembly_1__model_1

3f85__assembly_1__model_1 | I(q)

3f85__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

7. Citations (1)

Structure of fusion complex of homo trimeric major pilin subunits CfaB of CFA/I fimbirae from ETEC E. coli

1. Protein Identity and Related Structures Protein Identity & Related Structures

homo trimeric fusion of CFA/I fimbrial subunits B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3f85__assembly_1__model_1

3f85__assembly_1__model_1 | I(q)

3f85__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

7. Citations (1)