SAXSdb — 3fi7

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Lmo1076 protein

Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	SULFATE ION × 1 water × 1	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 4	SULFATE ION × 4 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8Y842_LISMO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–23； UniProt 52–71 Author chain A； PDBConstruct 24–183； UniProt 84–243

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3fi7
Deposition date deposition_date	2008-12-11
Structure title title	Crystal Structure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain
Keywords keywords	Listeria monocytogenes, autolysin, N acetylglucosaminidase, peptidoglycan hydrolase, autoinhibition, GH73, HYDROLASE; HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3fi7__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3fi7__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3fi7__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	20.39 Å
Rg (electron density)	19.70 Å
Total Rg	20.54 Å
Atom count	1426
Residues	177
Excluded volume	25051 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3fi7__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3fi7__assembly_2__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Lmo1076 protein
Molecular weight formula_weight	20745.9 kDa
EC 编号 ec_number	3.2.1.96
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	1589

GAMESEEPVFSLEQNRDDAMAALASTPTFQQTFINSISTQAMDLCKKYNLYPSVMIAQAALESNWGRSELGKAPNYNLFGIKGSYNGKSVTMKTWEYSDSKGWYQINANFAKYPSHKESLEDNAKKLRNGPSWDSSYYKGAWRENAKTYKDATAWLQGRYATDNTYASKLNTLISSYNLTQYD

Source Source

Source organism organism	Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
NCBI taxonomy ID ncbi_taxonomy_id	169963
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	158

▼

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	3fi7A01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	530 — Lysozyme
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3fi7A02
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	80 — Rhinovirus 14, subunit 4
Homologous superfamily homologous superfamily	30 — DNA polymerase; domain 6

▶

Unit-cell length a length_a	133.500 Å
Unit-cell length b length_b	133.500 Å
Unit-cell length c length_c	88.900 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 62 2 2
Space-group number int_tables_number	180
Crystal system crystal_system	—

Resolution resolution	2.350 Å
Low-resolution limit resolution_low	27.480 Å
R factor r_factor	0.1810
R_work r_work	0.1800
R_free r_free	0.2040

Crystal Structure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

Lmo1076 protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3fi7__assembly_1__model_1

3fi7__assembly_1__model_1 | I(q)

3fi7__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)

Crystal Structure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

Lmo1076 protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3fi7__assembly_1__model_1

3fi7__assembly_1__model_1 | I(q)

3fi7__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)