SAXSdb — 3frl

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

LipL32

Leptospira interrogans serovar Copenhageni

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	2,2',2''-NITRILOTRIETHANOL × 1 OXALATE ION × 2 CHLORIDE ION × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q72SM7_LEPIC
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–252； UniProt 21–272 Author chain B； PDBConstruct 1–252； UniProt 21–272

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3frl
Deposition date deposition_date	2009-01-08
Structure title title	The 2.25 A crystal structure of LipL32, the major surface antigen of Leptospira interrogans serovar Copenhageni
Keywords keywords	core jelly-roll fold, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3frl__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3frl__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3frl__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	25.18 Å
Rg (electron density)	24.31 Å
Total Rg	25.37 Å
Atom count	3616
Residues	453
Excluded volume	65016 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3frl__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	LipL32
Molecular weight formula_weight	27818.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	3919

GAFGGLPSLKSSFVLSEDTIPGTNETVKTLLPYGSVINYYGYVKPGQAPDGLVDGNKKAYYLYVWIPAVIAEMGVRMISPTGEIGEPGDGDLVSDAFKAATPEEKSMPHWFDTWIRVERMSAIMPDQIAKAAKAKPVQKLDDDDDGDDTYKEERHNKYNSLTRIKIPNPPKSFDDLKNIDTKKLLVRGLYRISFTTYKPGEVKGSFVASVGLLFPPGIPGVSPLIHSNPEELQKQAIAAEESLKKAASDATK

Source Source

Source organism organism	Leptospira interrogans serovar Copenhageni
NCBI taxonomy ID ncbi_taxonomy_id	44275
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	2,2',2''-NITRILOTRIETHANOL
Molecular weight formula_weight	149.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 non-polymer

Description description	OXALATE ION
Molecular weight formula_weight	88.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	272

▶

Unit-cell length a length_a	126.725 Å
Unit-cell length b length_b	126.725 Å
Unit-cell length c length_c	95.996 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 32 2 1
Space-group number int_tables_number	154
Crystal system crystal_system	—

Resolution resolution	2.250 Å
Low-resolution limit resolution_low	35.000 Å
R factor r_factor	0.1836
R_work r_work	0.1813
R_free r_free	0.2271

The 2.25 A crystal structure of LipL32, the major surface antigen of Leptospira interrogans serovar Copenhageni

1. Protein Identity and Related Structures Protein Identity & Related Structures

LipL32

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3frl__assembly_1__model_1

3frl__assembly_1__model_1 | I(q)

3frl__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)

The 2.25 A crystal structure of LipL32, the major surface antigen of Leptospira interrogans serovar Copenhageni

1. Protein Identity and Related Structures Protein Identity & Related Structures

LipL32

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3frl__assembly_1__model_1

3frl__assembly_1__model_1 | I(q)

3frl__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)