SAXSdb — 3fyb

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein of unknown function (DUF1244)

Alcanivorax borkumensis SK2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	CHLORIDE ION × 3 CALCIUM ION × 2 DI(HYDROXYETHYL)ETHER × 2 1,2-ETHANEDIOL × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q0VSW0_ALCBS
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–104； UniProt 1–103 Author chain B； PDBConstruct 2–104； UniProt 1–103

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3fyb
Deposition date deposition_date	2009-01-22
Structure title title	Crystal structure of a protein of unknown function (DUF1244) from Alcanivorax borkumensis
Keywords keywords	;unknown function, DUF1244, Alcanivorax borkumensis, hydrocarbon-degrading, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, Target APC7960 ;; STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3fyb__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3fyb__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3fyb__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	17.63 Å
Rg (electron density)	16.63 Å
Total Rg	17.54 Å
Atom count	1512
Residues	176
Excluded volume	26902 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3fyb__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Protein of unknown function (DUF1244)
Molecular weight formula_weight	12162.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	1726

GMADIDQASKTEMEAAAFRHLLRHLDEHKDVQNIDLMIQADFCRNCLAKWLMEAATEQGVELDYDGAREYVYGMPFAEWKTLYQKPASEAQLAAFEAKQAARKR

Source Source

Source organism organism	Alcanivorax borkumensis SK2
NCBI taxonomy ID ncbi_taxonomy_id	393595
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 3 Entity 3 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 non-polymer

Description description	DI(HYDROXYETHYL)ETHER
Molecular weight formula_weight	106.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 5 Entity 5 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	181

▼

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d3fyba1
Class class	a — All alpha proteins
Fold Fold fold	a.293 — SMc04008-like
Superfamily Superfamily superfamily	a.293.1 — SMc04008-like
Family Family family	a.293.1.0 — automated matches

Domain ID domain_id	d3fyba2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3fybb1
Class class	a — All alpha proteins
Fold Fold fold	a.293 — SMc04008-like
Superfamily Superfamily superfamily	a.293.1 — SMc04008-like
Family Family family	a.293.1.0 — automated matches

Domain ID domain_id	d3fybb2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (2 domains)

Domain ID domain_id	3fybA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3340 — SMc04008-like fold
Homologous superfamily homologous superfamily	10 — SMc04008-like

Domain ID domain_id	3fybB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3340 — SMc04008-like fold
Homologous superfamily homologous superfamily	10 — SMc04008-like

▶

Unit-cell length a length_a	40.501 Å
Unit-cell length b length_b	69.536 Å
Unit-cell length c length_c	81.921 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.800 Å
Low-resolution limit resolution_low	32.190 Å
R factor r_factor	0.1888
R_work r_work	0.1871
R_free r_free	0.2215

Crystal structure of a protein of unknown function (DUF1244) from Alcanivorax borkumensis

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein of unknown function (DUF1244)

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3fyb__assembly_1__model_1

3fyb__assembly_1__model_1 | I(q)

3fyb__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

CATH v4.4 (2 domains)

7. Citations (1)

Crystal structure of a protein of unknown function (DUF1244) from Alcanivorax borkumensis

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein of unknown function (DUF1244)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3fyb__assembly_1__model_1

3fyb__assembly_1__model_1 | I(q)

3fyb__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

CATH v4.4 (2 domains)

7. Citations (1)