SAXSdb — 3ggh

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

K88 fimbrial protein AD

Escherichia coli

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	SULFATE ION × 6 water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	SULFATE ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FAEG3_ECOLX
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–5； UniProt 22–25 Author chain A； PDBConstruct 12–254； UniProt 43–285 Author chain B； PDBConstruct 2–5； UniProt 22–25 Author chain B； PDBConstruct 12–254； UniProt 43–285

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3ggh
Deposition date deposition_date	2009-02-28
Structure title title	Donor strand complemented FaeG of F4ad fimbriae
Keywords keywords	immunoglobulin like fold, Fimbrium, CELL ADHESION; CELL ADHESION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3ggh__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3ggh__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3ggh__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	20.39 Å
Rg (electron density)	19.34 Å
Total Rg	20.23 Å
Atom count	1854
Residues	258
Excluded volume	32651 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3ggh__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3ggh__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	K88 fimbrial protein AD
Molecular weight formula_weight	28928.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	4410

MWMTGHHHHHHRQKWEWKVGTGLNGFGSVLNDLTNGGTKLTITVTGNKPILLGRTKEAFATPVTSGVDGIPHIAFTDYEGASVELRNPDGETEKGLAYFVLPMKNAEGTKVGSVKVNASYAGALGRGGVTSADGELMSLFAEGSHAIFYGGLPTNVKNSELKGGSAAAARTELFGSLSKNDILGQIQRVNANITSLVNVPGSFNENMAYTDGSVVSVAYALGIANGQTIEATFNQAVTTSTQWSAPLNVAITYYDNKQMTGDFNGSVDIGGSITA

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	498

▶

Unit-cell length a length_a	125.029 Å
Unit-cell length b length_b	125.029 Å
Unit-cell length c length_c	96.581 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 31 2 1
Space-group number int_tables_number	152
Crystal system crystal_system	—

Resolution resolution	1.639 Å
Low-resolution limit resolution_low	44.103 Å
R factor r_factor	0.1970
R_work r_work	0.1960
R_free r_free	0.2240

Donor strand complemented FaeG of F4ad fimbriae

1. Protein Identity and Related Structures Protein Identity & Related Structures

K88 fimbrial protein AD

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3ggh__assembly_2__model_1

3ggh__assembly_2__model_1 | I(q)

3ggh__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

7. Citations (1)

Donor strand complemented FaeG of F4ad fimbriae

1. Protein Identity and Related Structures Protein Identity & Related Structures

K88 fimbrial protein AD

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3ggh__assembly_2__model_1

3ggh__assembly_2__model_1 | I(q)

3ggh__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

7. Citations (1)