SAXSdb — 3ghp

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cellulosomal scaffoldin adaptor protein B

Acetivibrio cellulolyticus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	1,2-ETHANEDIOL × 6 water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	1,2-ETHANEDIOL × 8 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7WYN3_9FIRM
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–219； UniProt 190–408 Author chain B； PDBConstruct 1–219； UniProt 190–408

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3ghp
Deposition date deposition_date	2009-03-04
Structure title title	Structure of the second type II cohesin module from the adaptor ScaA scaffoldin of Acetivibrio cellulolyticus (including long C-terminal linker)
Keywords keywords	Linker segments, beta barrel, alpha helix, beta flaps, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3ghp__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3ghp__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3ghp__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	18.48 Å
Rg (electron density)	17.46 Å
Total Rg	18.58 Å
Atom count	1421
Residues	183
Excluded volume	25568 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3ghp__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3ghp__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Cellulosomal scaffoldin adaptor protein B
Molecular weight formula_weight	24484.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	2975

VINLDMIKASYITMGYDKNAAEVGEIIKATVKINKITNFSGYQVNIKYDPTVLQAVNPKTGVAYTNSSLPTSGELLVSEDYGPIVQGVHKISEGILNLSRSYTALEVYRASESPEETGTLAVVGFKVLQKKATTVVFEDSETMPNGITGTTLFNWYGNRIQSGYFVIQPGEINSAPIATATPTTKPTAFASTMPTVTLTPTPTATTTTTIPTAVPTTESLEHHHHHH

Source Source

Source organism organism	Acetivibrio cellulolyticus
NCBI taxonomy ID ncbi_taxonomy_id	35830
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	14

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	73

▼

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d3ghpb_
Class class	b — All beta proteins
Fold Fold fold	b.2 — Common fold of diphtheria toxin/transcription factors/cytochrome f
Superfamily Superfamily superfamily	b.2.2 — Carbohydrate-binding domain
Family Family family	b.2.2.2 — Cellulose-binding domain family III

CATH v4.4 (2 domains)

Domain ID domain_id	3ghpA00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	680 —

Domain ID domain_id	3ghpB00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	680 —

▶

Unit-cell length a length_a	68.759 Å
Unit-cell length b length_b	159.221 Å
Unit-cell length c length_c	44.213 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	2.487 Å
Low-resolution limit resolution_low	42.601 Å
R factor r_factor	0.2170
R_work r_work	0.2120
R_free r_free	0.3170

Structure of the second type II cohesin module from the adaptor ScaA scaffoldin of Acetivibrio cellulolyticus (including long C-terminal linker)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cellulosomal scaffoldin adaptor protein B

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3ghp__assembly_2__model_1

3ghp__assembly_2__model_1 | I(q)

3ghp__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (1 domains)

CATH v4.4 (2 domains)

7. Citations (2)

Structure of the second type II cohesin module from the adaptor ScaA scaffoldin of Acetivibrio cellulolyticus (including long C-terminal linker)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cellulosomal scaffoldin adaptor protein B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3ghp__assembly_2__model_1

3ghp__assembly_2__model_1 | I(q)

3ghp__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (1 domains)

CATH v4.4 (2 domains)

7. Citations (2)