SAXSdb — 3hgw

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Salicylate biosynthesis protein pchB

Pseudomonas aeruginosa

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	CALCIUM ION × 1 water × 2	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PCHB_PSEAE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–98； UniProt 1–98 Author chain B； PDBConstruct 1–98； UniProt 1–98 Author chain C； PDBConstruct 1–98； UniProt 1–98 Author chain D； PDBConstruct 1–98； UniProt 1–98

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3hgw
Deposition date deposition_date	2009-05-14
Structure title title	Apo Structure of Pseudomonas aeruginosa Isochorismate-Pyruvate Lyase I87T mutant
Keywords keywords	siderophore biosynthesis, pyochelin, isochorismate-pyruvate lyase, chorismate mutase, PchB, Lyase; LYASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3hgw__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3hgw__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3hgw__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	17.13 Å
Rg (electron density)	16.15 Å
Total Rg	17.14 Å
Atom count	1270
Residues	156
Excluded volume	22584 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3hgw__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3hgw__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Salicylate biosynthesis protein pchB
Molecular weight formula_weight	11435.0 kDa
EC 编号 ec_number	4.1.99.-
Mutation mutation	I87T
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D,A,B
Atom count atom_count	2799

MKTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFKASEAAIPAPERVAAMLPERARWAEENGLDAPFVEGLFAQIIHWYTAEQIKYWRQTRGAA

Source Source

Source organism organism	Pseudomonas aeruginosa
NCBI taxonomy ID ncbi_taxonomy_id	287
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	76

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d3hgwa_
Class class	a — All alpha proteins
Fold Fold fold	a.130 — Chorismate mutase II
Superfamily Superfamily superfamily	a.130.1 — Chorismate mutase II
Family Family family	a.130.1.1 — Dimeric chorismate mutase

Domain ID domain_id	d3hgwb_
Class class	a — All alpha proteins
Fold Fold fold	a.130 — Chorismate mutase II
Superfamily Superfamily superfamily	a.130.1 — Chorismate mutase II
Family Family family	a.130.1.1 — Dimeric chorismate mutase

Domain ID domain_id	d3hgwc_
Class class	a — All alpha proteins
Fold Fold fold	a.130 — Chorismate mutase II
Superfamily Superfamily superfamily	a.130.1 — Chorismate mutase II
Family Family family	a.130.1.1 — Dimeric chorismate mutase

Domain ID domain_id	d3hgwd_
Class class	a — All alpha proteins
Fold Fold fold	a.130 — Chorismate mutase II
Superfamily Superfamily superfamily	a.130.1 — Chorismate mutase II
Family Family family	a.130.1.1 — Dimeric chorismate mutase

CATH v4.4 (4 domains)

Domain ID domain_id	3hgwA00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	59 — Chorismate Mutase Domain, subunit A
Homologous superfamily homologous superfamily	10 — Chorismate mutase

Domain ID domain_id	3hgwB00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	59 — Chorismate Mutase Domain, subunit A
Homologous superfamily homologous superfamily	10 — Chorismate mutase

Domain ID domain_id	3hgwC00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	59 — Chorismate Mutase Domain, subunit A
Homologous superfamily homologous superfamily	10 — Chorismate mutase

Domain ID domain_id	3hgwD00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	59 — Chorismate Mutase Domain, subunit A
Homologous superfamily homologous superfamily	10 — Chorismate mutase

▶

Unit-cell length a length_a	54.503 Å
Unit-cell length b length_b	74.919 Å
Unit-cell length c length_c	88.505 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.250 Å
Low-resolution limit resolution_low	23.210 Å
R factor r_factor	0.2210
R_work r_work	0.2190
R_free r_free	0.2560

Apo Structure of Pseudomonas aeruginosa Isochorismate-Pyruvate Lyase I87T mutant

1. Protein Identity and Related Structures Protein Identity & Related Structures

Salicylate biosynthesis protein pchB

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3hgw__assembly_2__model_1

3hgw__assembly_2__model_1 | I(q)

3hgw__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Apo Structure of Pseudomonas aeruginosa Isochorismate-Pyruvate Lyase I87T mutant

1. Protein Identity and Related Structures Protein Identity & Related Structures

Salicylate biosynthesis protein pchB

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3hgw__assembly_2__model_1

3hgw__assembly_2__model_1 | I(q)

3hgw__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)