SAXSdb — 3hp8

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cyanovirin-N-like protein

Tuber borchii

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1 其他Polymer 2	beta-D-fructofuranose-(2-1)-alpha-D-glucopyranose × 2 2,3-DIHYDROXY-1,4-DITHIOBUTANE × 1 water × 1	Consistent with protein count
2	Insufficient information	Monomer	Protein 1 其他Polymer 2	beta-D-fructofuranose-(2-1)-alpha-D-glucopyranose × 2 2,3-DIHYDROXY-1,4-DITHIOBUTANE × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q5MK11_TUBBO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–42； UniProt 1–39 Author chain A； PDBConstruct 97–110； UniProt 90–103 Author chain B； PDBConstruct 4–42； UniProt 1–39 Author chain B； PDBConstruct 97–110； UniProt 90–103

Cyanovirin-N-like protein

Tuber borchii

UniProt Q7S6U4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1 其他Polymer 2	beta-D-fructofuranose-(2-1)-alpha-D-glucopyranose × 2 2,3-DIHYDROXY-1,4-DITHIOBUTANE × 1 water × 1	Consistent with protein count
2	Insufficient information	Monomer	Protein 1 其他Polymer 2	beta-D-fructofuranose-(2-1)-alpha-D-glucopyranose × 2 2,3-DIHYDROXY-1,4-DITHIOBUTANE × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7S6U4_NEUCR
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 43–96； UniProt 42–95 Author chain B； PDBConstruct 43–96； UniProt 42–95

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3hp8
Deposition date deposition_date	2009-06-03
Structure title title	Crystal structure of a designed Cyanovirin-N homolog lectin; LKAMG, bound to sucrose
Keywords keywords	Cyanovirin-N, CVNH, lectin, carbohydrate, sucrose, SUGAR BINDING PROTEIN; SUGAR BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3hp8__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3hp8__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3hp8__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	15.88 Å
Rg (electron density)	14.52 Å
Total Rg	15.59 Å
Atom count	905
Residues	107
Excluded volume	15574 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3hp8__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3hp8__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Cyanovirin-N-like protein
Molecular weight formula_weight	12386.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	2067

GSHMSYADSSRNAVLTNGGRTLRAECRNADGNWVTSELDLDTIIGNNDGHFQWGGQNFTETAEDIRFHPKEGAAEQPILRARLRDCNGEFHDRDVNLNRIQNVNGRLVFQ

Source Source

Source organism organism	Tuber borchii
NCBI taxonomy ID ncbi_taxonomy_id	42251
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 branched

Description description	beta-D-fructofuranose-(2-1)-alpha-D-glucopyranose
Molecular weight formula_weight	342.3 kDa
Source method src_method	man
Copy count entity_count	4

Entity 3 Entity 3 non-polymer

Description description	2,3-DIHYDROXY-1,4-DITHIOBUTANE
Molecular weight formula_weight	154.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	242

▼

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	3hp8A00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	60 — HIV-inactivating Protein, Cyanovirin-n
Homologous superfamily homologous superfamily	10 — Cyanovirin-N

Domain ID domain_id	3hp8B00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	60 — HIV-inactivating Protein, Cyanovirin-n
Homologous superfamily homologous superfamily	10 — Cyanovirin-N

▶

Unit-cell length a length_a	44.497 Å
Unit-cell length b length_b	39.298 Å
Unit-cell length c length_c	86.134 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	97.64 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.000 Å
Low-resolution limit resolution_low	35.700 Å
R factor r_factor	0.2270
R_work r_work	0.2240
R_free r_free	0.2770

Crystal structure of a designed Cyanovirin-N homolog lectin; LKAMG, bound to sucrose

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cyanovirin-N-like protein

State in the Current Structure

Other States of the Same Protein in the Database

Cyanovirin-N-like protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3hp8__assembly_2__model_1

3hp8__assembly_2__model_1 | I(q)

3hp8__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 branched

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (2)

Crystal structure of a designed Cyanovirin-N homolog lectin; LKAMG, bound to sucrose

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cyanovirin-N-like protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cyanovirin-N-like protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3hp8__assembly_2__model_1

3hp8__assembly_2__model_1 | I(q)

3hp8__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 branched

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (2)