SAXSdb — 3ilm

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Alr3790 protein

Nostoc sp.

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	MANGANESE (II) ION × 2 water × 2	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	MANGANESE (II) ION × 3 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8YQN0_ANASP
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–133； UniProt 20–151 Author chain B； PDBConstruct 2–133； UniProt 20–151 Author chain C； PDBConstruct 2–133； UniProt 20–151 Author chain D； PDBConstruct 2–133； UniProt 20–151

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3ilm
Deposition date deposition_date	2009-08-07
Structure title title	Crystal Structure of the Alr3790 protein from Anabaena sp. Northeast Structural Genomics Consortium Target NsR437h
Keywords keywords	;Alr3790, Rhodanese-like, NsR437h, NESG, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION ;; STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3ilm__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3ilm__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3ilm__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	18.97 Å
Rg (electron density)	18.16 Å
Total Rg	18.73 Å
Atom count	1918
Residues	243
Excluded volume	33783 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3ilm__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3ilm__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Alr3790 protein
Molecular weight formula_weight	15901.9 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	3868

MSDAHVLKSRLEWGEPAFTILDVRDRSTYNDGHIMGAMAMPIEDLVDRASSSLEKSRDIYVYGAGDEQTSQAVNLLRSAGFEHVSELKGGLAAWKAIGGPTEGIIESRTPAGADDYNVVSRMQNHLENQKKEVLEHHHHHH

Source Source

Source organism organism	Nostoc sp.
NCBI taxonomy ID ncbi_taxonomy_id	103690
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	MANGANESE (II) ION
Molecular weight formula_weight	54.9 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	149

▼

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	3ilmA00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	250 — Oxidized Rhodanese; domain 1
Homologous superfamily homologous superfamily	10 — Rhodanese-like domain

Domain ID domain_id	3ilmB00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	250 — Oxidized Rhodanese; domain 1
Homologous superfamily homologous superfamily	10 — Rhodanese-like domain

Domain ID domain_id	3ilmC00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	250 — Oxidized Rhodanese; domain 1
Homologous superfamily homologous superfamily	10 — Rhodanese-like domain

Domain ID domain_id	3ilmD00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	250 — Oxidized Rhodanese; domain 1
Homologous superfamily homologous superfamily	10 — Rhodanese-like domain

▶

Unit-cell length a length_a	42.694 Å
Unit-cell length b length_b	77.293 Å
Unit-cell length c length_c	156.836 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.262 Å
Low-resolution limit resolution_low	41.195 Å
R factor r_factor	0.2327
R_work r_work	0.2320
R_free r_free	0.2452

Crystal Structure of the Alr3790 protein from Anabaena sp. Northeast Structural Genomics Consortium Target NsR437h

1. Protein Identity and Related Structures Protein Identity & Related Structures

Alr3790 protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3ilm__assembly_2__model_1

3ilm__assembly_2__model_1 | I(q)

3ilm__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)

Crystal Structure of the Alr3790 protein from Anabaena sp. Northeast Structural Genomics Consortium Target NsR437h

1. Protein Identity and Related Structures Protein Identity & Related Structures

Alr3790 protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3ilm__assembly_2__model_1

3ilm__assembly_2__model_1 | I(q)

3ilm__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)