3j16

Models of ribosome-bound Dom34p and Rli1p and their ribosomal binding partners

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Dom34p

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 9 RNA 3	Rli1p × 1 （Q03195） 28S ribosomal RNA × 1 18S ribosomal RNA × 1 P-site tRNA × 1 60S ribosomal protein L6 × 1 （P05738） 40S ribosomal protein S30E × 1 （P0CX33） 60S ribosomal protein L10 × 1 （P05317） 40S ribosomal protein S6E × 1 （P0CX37） 60S ribosomal protein L11 × 1 （P0CX53） 40S ribosomal protein S24E × 1 （P0CX41） 40S ribosomal protein S24-A × 1 （P0CX31） MAGNESIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 IRON/SULFUR CLUSTER × 2 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DOM34_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–386； UniProt 1–386

Rli1p

OrganismNot specified

UniProt Q03195

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 9 RNA 3	Dom34p × 1 （P33309） 28S ribosomal RNA × 1 18S ribosomal RNA × 1 P-site tRNA × 1 60S ribosomal protein L6 × 1 （P05738） 40S ribosomal protein S30E × 1 （P0CX33） 60S ribosomal protein L10 × 1 （P05317） 40S ribosomal protein S6E × 1 （P0CX37） 60S ribosomal protein L11 × 1 （P0CX53） 40S ribosomal protein S24E × 1 （P0CX41） 40S ribosomal protein S24-A × 1 （P0CX31） MAGNESIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 IRON/SULFUR CLUSTER × 2 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RLI1_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–608； UniProt 1–608

60S ribosomal protein L6

OrganismNot specified

UniProt P05738

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 9 RNA 3	Dom34p × 1 （P33309） Rli1p × 1 （Q03195） 28S ribosomal RNA × 1 18S ribosomal RNA × 1 P-site tRNA × 1 40S ribosomal protein S30E × 1 （P0CX33） 60S ribosomal protein L10 × 1 （P05317） 40S ribosomal protein S6E × 1 （P0CX37） 60S ribosomal protein L11 × 1 （P0CX53） 40S ribosomal protein S24E × 1 （P0CX41） 40S ribosomal protein S24-A × 1 （P0CX31） MAGNESIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 IRON/SULFUR CLUSTER × 2 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL9A_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–191； UniProt 1–191

40S ribosomal protein S30E

OrganismNot specified

UniProt P0CX33

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 9 RNA 3	Dom34p × 1 （P33309） Rli1p × 1 （Q03195） 28S ribosomal RNA × 1 18S ribosomal RNA × 1 P-site tRNA × 1 60S ribosomal protein L6 × 1 （P05738） 60S ribosomal protein L10 × 1 （P05317） 40S ribosomal protein S6E × 1 （P0CX37） 60S ribosomal protein L11 × 1 （P0CX53） 40S ribosomal protein S24E × 1 （P0CX41） 40S ribosomal protein S24-A × 1 （P0CX31） MAGNESIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 IRON/SULFUR CLUSTER × 2 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS30A_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain E； PDBConstruct 1–63； UniProt 1–63

60S ribosomal protein L10

OrganismNot specified

UniProt P05317

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 9 RNA 3	Dom34p × 1 （P33309） Rli1p × 1 （Q03195） 28S ribosomal RNA × 1 18S ribosomal RNA × 1 P-site tRNA × 1 60S ribosomal protein L6 × 1 （P05738） 40S ribosomal protein S30E × 1 （P0CX33） 40S ribosomal protein S6E × 1 （P0CX37） 60S ribosomal protein L11 × 1 （P0CX53） 40S ribosomal protein S24E × 1 （P0CX41） 40S ribosomal protein S24-A × 1 （P0CX31） MAGNESIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 IRON/SULFUR CLUSTER × 2 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RLA0_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain G； PDBConstruct 1–312； UniProt 1–312

40S ribosomal protein S6E

OrganismNot specified

UniProt P0CX37

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 9 RNA 3	Dom34p × 1 （P33309） Rli1p × 1 （Q03195） 28S ribosomal RNA × 1 18S ribosomal RNA × 1 P-site tRNA × 1 60S ribosomal protein L6 × 1 （P05738） 40S ribosomal protein S30E × 1 （P0CX33） 60S ribosomal protein L10 × 1 （P05317） 60S ribosomal protein L11 × 1 （P0CX53） 40S ribosomal protein S24E × 1 （P0CX41） 40S ribosomal protein S24-A × 1 （P0CX31） MAGNESIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 IRON/SULFUR CLUSTER × 2 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS6A_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain C； PDBConstruct 1–236； UniProt 1–236

60S ribosomal protein L11

OrganismNot specified

UniProt P0CX53

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 9 RNA 3	Dom34p × 1 （P33309） Rli1p × 1 （Q03195） 28S ribosomal RNA × 1 18S ribosomal RNA × 1 P-site tRNA × 1 60S ribosomal protein L6 × 1 （P05738） 40S ribosomal protein S30E × 1 （P0CX33） 60S ribosomal protein L10 × 1 （P05317） 40S ribosomal protein S6E × 1 （P0CX37） 40S ribosomal protein S24E × 1 （P0CX41） 40S ribosomal protein S24-A × 1 （P0CX31） MAGNESIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 IRON/SULFUR CLUSTER × 2 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL12A_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain H； PDBConstruct 1–165； UniProt 1–165

40S ribosomal protein S24E

OrganismNot specified

UniProt P0CX41

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 9 RNA 3	Dom34p × 1 （P33309） Rli1p × 1 （Q03195） 28S ribosomal RNA × 1 18S ribosomal RNA × 1 P-site tRNA × 1 60S ribosomal protein L6 × 1 （P05738） 40S ribosomal protein S30E × 1 （P0CX33） 60S ribosomal protein L10 × 1 （P05317） 40S ribosomal protein S6E × 1 （P0CX37） 60S ribosomal protein L11 × 1 （P0CX53） 40S ribosomal protein S24-A × 1 （P0CX31） MAGNESIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 IRON/SULFUR CLUSTER × 2 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL23A_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain I； PDBConstruct 1–137； UniProt 1–137

40S ribosomal protein S24-A

OrganismNot specified

UniProt P0CX31

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 9 RNA 3	Dom34p × 1 （P33309） Rli1p × 1 （Q03195） 28S ribosomal RNA × 1 18S ribosomal RNA × 1 P-site tRNA × 1 60S ribosomal protein L6 × 1 （P05738） 40S ribosomal protein S30E × 1 （P0CX33） 60S ribosomal protein L10 × 1 （P05317） 40S ribosomal protein S6E × 1 （P0CX37） 60S ribosomal protein L11 × 1 （P0CX53） 40S ribosomal protein S24E × 1 （P0CX41） MAGNESIUM ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 IRON/SULFUR CLUSTER × 2 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS24A_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain D； PDBConstruct 1–135； UniProt 1–135

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3j16
Deposition date deposition_date	2011-12-12
Structure title title	Models of ribosome-bound Dom34p and Rli1p and their ribosomal binding partners
Keywords keywords	ribosome recycling, translation, eukarya, RIBOSOME; RIBOSOME
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3j16__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3j16__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3j16__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	58.59 Å
Rg (electron density)	58.57 Å
Total Rg	58.55 Å
Atom count	26207
Residues	2536
Excluded volume	434190 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3j16__assembly_1__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (16)

Entity 1 Entity 1 polymer

Description description	Dom34p
Molecular weight formula_weight	44119.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	26208

MKVISLKKDSFNKGGAVITLLPEDKEDLFTVYQIVDKDDELIFKKKFTSKLDEAGKKKSTDLVKLKIKVISEDFDMKDEYLKYKGVTVTDESGASNVDIPVGKYLSFTLDYVYPFTIIKQNFNKFMQKLLNEACNIEYKSDTAAVVLQEGIAHVCLVTSSSTILKQKIEYSMPKKKRTTDVLKFDEKTEKFYKAIYSAMKKDLNFDKLKTIILCSPGFYAKILMDKIFQYAEEEHNKKILDNKGMFFIAHCSTGYLQGINEVLKNPLYASKLQDTKYSKEIMVMDEFLLHLNKDDDKAWYGEKEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKALVLSTLHSLGEELDQLTGIACILKYPLPDLDEDDGEE

Entity 2 Entity 2 polymer

Description description	Rli1p
Molecular weight formula_weight	68433.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSDKNSRIAIVSADKCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGICVKKCPFDAIQIINLPTNLEAHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVLDYLSDFVCIIYGVPSVYGVVTLPASVREGINIFLDGHIPAENLRFRTEALQFRIADATEDLQNDSASRAFSYPSLKKTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQKIAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVKPLRIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFEGIPSKNAHARAPESLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKSSGNYFFLDNTGI

Entity 3 Entity 3 polymer

Description description	28S ribosomal RNA
Molecular weight formula_weight	75106.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	J

CUCAAAGAUUAAGCCAUGUGGUAAUUCUAAUCCAAGGAAAGCAGGCGCGCAAAUUACCCAAUCCUAAUUCAGGGAGGUAGUGAGGAGGGCAAGUCUGGUGCCAGCAGCCGCGGUAAUUCCAGCUCCUGCGGCUUAAUUUGACUCAACACGGGGAAACUCACCUGGUGGUGCAUGGCAGGUCUGUGAUGCCCUUACACACCGCCCGUCGCUAGUACUAAAAGUCGUAACAAGGU

Entity 4 Entity 4 polymer

Description description	18S ribosomal RNA
Molecular weight formula_weight	49863.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	K

CCGGACGGUGGCCAUGGAAGUCGGAAUCCGCUAAGGAGUGUGUAACAACUCACCGGCGGAGUAACUAUGACUCUCGCCUCGUCAUCUAAUUAAGUCAAGCGUUCAUAGCGACAUUGAUUGUUCACCCACUGAACUUAGUACGAGAGGAACAGUUC

Entity 5 Entity 5 polymer

Description description	P-site tRNA
Molecular weight formula_weight	24135.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	L

UCCGUGAUAGUUUAAUGGUCAGAAUGGGCGCUUGUCGCGUGCCAGAUCGGGGUUCAAUUCCCCGUCGCGGAGCCA

Entity 6 Entity 6 polymer

Description description	60S ribosomal protein L6
Molecular weight formula_weight	21605.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MKYIQTEQQIEVPEGVTVSIKSRIVKVVGPRGTLTKNLKHIDVTFTKVNNQLIKVAVHNGGRKHVAALRTVKSLVDNMITGVTKGYKYKMRYVYAHFPINVNIVEKDGAKFIEVRNFLGDKKIRNVPVRDGVTIEFSTNVKDEIVLSGNSVEDVSQNAADLQQICRVRNKDIRKFLDGIYVSHKGFITEDL

Entity 7 Entity 7 polymer

Description description	40S ribosomal protein S30E
Molecular weight formula_weight	7137.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MAKVHGSLARAGKVKSQTPKVEKTEKPKKPKGRAYKRLLYTRRFVNVTLVNGKRRMNPGPSVQ

Entity 8 Entity 8 polymer

Description description	60S ribosomal protein L10
Molecular weight formula_weight	33749.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MGGIREKKAEYFAKLREYLEEYKSLFVVGVDNVSSQQMHEVRKELRGRAVVLMGKNTMVRRAIRGFLSDLPDFEKLLPFVKGNVGFVFTNEPLTEIKNVIVSNRVAAPARAGAVAPEDIWVRAVNTGMEPGKTSFFQALGVPTKIARGTIEIVSDVKVVDAGNKVGQSEASLLNLLNISPFTFGLTVVQVYDNGQVFPSSILDITDEELVSHFVSAVSTIASISLAIGYPTLPSVGHTLINNYKDLLAVAIAASYHYPEIEDLVDRIENPEKYAAAAPAATSAASGDAAPAEEAAAEEEEESDDDMGFGLFD

Entity 9 Entity 9 polymer

Description description	40S ribosomal protein S6E
Molecular weight formula_weight	27054.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MKLNISYPVNGSQKTFEIDDEHRIRVFFDKRIGQEVDGEAVGDEFKGYVFKISGGNDKQGFPMKQGVLLPTRIKLLLTKNVSCYRPRRDGERKRKSVRGAIVGPDLAVLALVIVKKGEQELEGLTDTTVPKRLGPKRANNIRKFFGLSKEDDVRDFVIRREVTKGEKTYTKAPKIQRLVTPQRLQRKRHQRALKVRNAQAQREAAAEYAQLLAKRLSERKAEKAEIRKRRASSLKA

Entity 10 Entity 10 polymer

Description description	60S ribosomal protein L11
Molecular weight formula_weight	17850.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MPPKFDPNEVKYLYLRAVGGEVGASAALAPKIGPLGLSPKKVGEDIAKATKEFKGIKVTVQLKIQNRQAAASVVPSASSLVITALKEPPRDRKKDKNVKHSGNIQLDEIIEIARQMRDKSFGRTLASVTKEILGTAQSVGCRVDFKNPHDIIEGINAGEIEIPEN

Entity 11 Entity 11 polymer

Description description	40S ribosomal protein S24E
Molecular weight formula_weight	14494.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MSGNGAQGTKFRISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPAASLGDMVMATVKKGKPELRKKVMPAIVVRQAKSWRRRDGVFLYFEDNAGVIANPKGEMKGSAITGPVGKECADLWPRVASNSGVVV

Entity 12 Entity 12 polymer

Description description	40S ribosomal protein S24-A
Molecular weight formula_weight	15362.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MSDAVTIRTRKVISNPLLARKQFVVDVLHPNRANVSKDELREKLAEVYKAEKDAVSVFGFRTQFGGGKSVGFGLVYNSVAEAKKFEPTYRLVRYGLAEKVEKASRQQRKQKKNRDKKIFGTGKRLAKKVARRNAD

Entity 13 Entity 13 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 14 Entity 14 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 15 Entity 15 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 16 Entity 16 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	7.20 Å
Resolution测定Method resolution_method	Single particle
颗粒数 num_particles	45700

Models of ribosome-bound Dom34p and Rli1p and their ribosomal binding partners

1. Protein Identity and Related Structures Protein Identity & Related Structures

Dom34p

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Rli1p

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

60S ribosomal protein L6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

40S ribosomal protein S30E

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

60S ribosomal protein L10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

40S ribosomal protein S6E

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

60S ribosomal protein L11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

40S ribosomal protein S24E

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

40S ribosomal protein S24-A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3j16__assembly_1__model_1

3j16__assembly_1__model_1 | I(q)

3j16__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment