SAXSdb — 3ku9

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Polyamine oxidase

Zea mays

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain A； UniProt 29–500	Mutation：K300M	FAD FLAVIN-ADENINE DINUCLEOTIDE × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SPM SPERMINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions：pH 4.6；293 K；50% SATURATED AMMONIUM SULFATE SOLUTION, 0.1M SODIUM ACETATE PH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.20 Å R-free 0.219
2	Other combination Monomer Protein × 1 其他Polymer 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain B； UniProt 29–500	Mutation：K300M	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 FAD FLAVIN-ADENINE DINUCLEOTIDE × 1 SPM SPERMINE × 1 CL CHLORIDE ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：pH 4.6；293 K；50% SATURATED AMMONIUM SULFATE SOLUTION, 0.1M SODIUM ACETATE PH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.20 Å R-free 0.219
3	Other combination Homooligomer Protein × 2 其他Polymer 1 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 29–500 Chain B； UniProt 29–500	Mutation：K300M	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 FAD FLAVIN-ADENINE DINUCLEOTIDE × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SPM SPERMINE × 2 CL CHLORIDE ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：pH 4.6；293 K；50% SATURATED AMMONIUM SULFATE SOLUTION, 0.1M SODIUM ACETATE PH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.20 Å R-free 0.219

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 3KU9	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1B37 A 30 ANGSTROM U-SHAPED CATALYTIC TUNNEL IN THE CRYSTAL STRUCTURE OF POLYAMINE OXIDASE Deposited 1998-12-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 29–500（472 aa） Fragment：FAD-BINDING DOMAIN	Not recorded	FAD FLAVIN-ADENINE DINUCLEOTIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；pH 4.6	Resolution 1.90 Å
1B37 A 30 ANGSTROM U-SHAPED CATALYTIC TUNNEL IN THE CRYSTAL STRUCTURE OF POLYAMINE OXIDASE Deposited 1998-12-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain B 29–500（472 aa） Fragment：FAD-BINDING DOMAIN	Not recorded	FAD FLAVIN-ADENINE DINUCLEOTIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；pH 4.6	Resolution 1.90 Å
1B37 A 30 ANGSTROM U-SHAPED CATALYTIC TUNNEL IN THE CRYSTAL STRUCTURE OF POLYAMINE OXIDASE Deposited 1998-12-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain C 29–500（472 aa） Fragment：FAD-BINDING DOMAIN	Not recorded	FAD FLAVIN-ADENINE DINUCLEOTIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；pH 4.6	Resolution 1.90 Å
1B37 A 30 ANGSTROM U-SHAPED CATALYTIC TUNNEL IN THE CRYSTAL STRUCTURE OF POLYAMINE OXIDASE Deposited 1998-12-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 29–500（472 aa） Fragment：FAD-BINDING DOMAIN Chain B 29–500（472 aa） Fragment：FAD-BINDING DOMAIN Chain C 29–500（472 aa） Fragment：FAD-BINDING DOMAIN	Not recorded	FAD FLAVIN-ADENINE DINUCLEOTIDE × 6	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；pH 4.6	Resolution 1.90 Å
1B37 A 30 ANGSTROM U-SHAPED CATALYTIC TUNNEL IN THE CRYSTAL STRUCTURE OF POLYAMINE OXIDASE Deposited 1998-12-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 29–500（472 aa） Fragment：FAD-BINDING DOMAIN Chain B 29–500（472 aa） Fragment：FAD-BINDING DOMAIN	Not recorded	FAD FLAVIN-ADENINE DINUCLEOTIDE × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；pH 4.6	Resolution 1.90 Å
1B37 A 30 ANGSTROM U-SHAPED CATALYTIC TUNNEL IN THE CRYSTAL STRUCTURE OF POLYAMINE OXIDASE Deposited 1998-12-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 29–500（472 aa） Fragment：FAD-BINDING DOMAIN	Not recorded	FAD FLAVIN-ADENINE DINUCLEOTIDE × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；pH 4.6	Resolution 1.90 Å
1H81 STRUCTURE OF POLYAMINE OXIDASE IN THE REDUCED STATE Deposited 2001-01-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 29–500（472 aa） Fragment：FAD-BINDING DOMAIN RESIDUES 29-500 Chain B 29–500（472 aa） Fragment：FAD-BINDING DOMAIN RESIDUES 29-500	Not recorded	FAD FLAVIN-ADENINE DINUCLEOTIDE × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；pH 4.60	Resolution 2.10 Å R-free 0.235
1H81 STRUCTURE OF POLYAMINE OXIDASE IN THE REDUCED STATE Deposited 2001-01-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 29–500（472 aa） Fragment：FAD-BINDING DOMAIN RESIDUES 29-500	Not recorded	FAD FLAVIN-ADENINE DINUCLEOTIDE × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；pH 4.60	Resolution 2.10 Å R-free 0.235
1H82 STRUCTURE OF POLYAMINE OXIDASE IN COMPLEX WITH GUAZATINE Deposited 2001-01-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 29–500（472 aa） Fragment：FAD-BINDING DOMAIN RESIDUES 29-500 Chain B 29–500（472 aa） Fragment：FAD-BINDING DOMAIN RESIDUES 29-500	Not recorded	FAD FLAVIN-ADENINE DINUCLEOTIDE × 2 GZZ N-{8-[(8-{[(E)-AMINO(IMINO)METHYL]AMINO}OCTYL)AMINO]OCTYL}GUANIDINE × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；pH 4.60	Resolution 1.90 Å R-free 0.231
1H82 STRUCTURE OF POLYAMINE OXIDASE IN COMPLEX WITH GUAZATINE Deposited 2001-01-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 29–500（472 aa） Fragment：FAD-BINDING DOMAIN RESIDUES 29-500	Not recorded	FAD FLAVIN-ADENINE DINUCLEOTIDE × 2 GZZ N-{8-[(8-{[(E)-AMINO(IMINO)METHYL]AMINO}OCTYL)AMINO]OCTYL}GUANIDINE × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；pH 4.60	Resolution 1.90 Å R-free 0.231
1H83 STRUCTURE OF POLYAMINE OXIDASE IN COMPLEX WITH 1,8-DIAMINOOCTANE Deposited 2001-01-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 29–500（472 aa） Fragment：FAD-BINDING DOMAIN Chain B 29–500（472 aa） Fragment：FAD-BINDING DOMAIN	Not recorded	FAD FLAVIN-ADENINE DINUCLEOTIDE × 2 DIA OCTANE 1,8-DIAMINE × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；pH 4.60	Resolution 1.90 Å R-free 0.237
1H83 STRUCTURE OF POLYAMINE OXIDASE IN COMPLEX WITH 1,8-DIAMINOOCTANE Deposited 2001-01-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 29–500（472 aa） Fragment：FAD-BINDING DOMAIN	Not recorded	FAD FLAVIN-ADENINE DINUCLEOTIDE × 2 DIA OCTANE 1,8-DIAMINE × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；pH 4.60	Resolution 1.90 Å R-free 0.237
1H84 COVALENT ADDUCT BETWEEN POLYAMINE OXIDASE AND N1ethylN11((cycloheptyl)methyl)4,8diazaundecane at pH 4.6 Deposited 2001-01-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 29–500（472 aa） Fragment：FAD-BINDING DOMAIN Chain B 29–500（472 aa） Fragment：FAD-BINDING DOMAIN	Not recorded	FAD FLAVIN-ADENINE DINUCLEOTIDE × 2 NBA 3-[(3-{[3-(METHYLAMINO)PROPYL]AMINO}PROPYL)AMINO]PROPANE-1,1-DIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；pH 4.60	Resolution 2.00 Å R-free 0.227
1H84 COVALENT ADDUCT BETWEEN POLYAMINE OXIDASE AND N1ethylN11((cycloheptyl)methyl)4,8diazaundecane at pH 4.6 Deposited 2001-01-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 29–500（472 aa） Fragment：FAD-BINDING DOMAIN	Not recorded	FAD FLAVIN-ADENINE DINUCLEOTIDE × 2 NBA 3-[(3-{[3-(METHYLAMINO)PROPYL]AMINO}PROPYL)AMINO]PROPANE-1,1-DIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；pH 4.60	Resolution 2.00 Å R-free 0.227
1H86 COVALENT ADDUCT BETWEEN POLYAMINE OXIDASE AND N1ethylN11((cycloheptyl)methyl)4,8diazaundecane at pH 7.0 Deposited 2001-01-24	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 29–500（472 aa） Chain B 29–500（472 aa）	Not recorded	FAD FLAVIN-ADENINE DINUCLEOTIDE × 2 NBA 3-[(3-{[3-(METHYLAMINO)PROPYL]AMINO}PROPYL)AMINO]PROPANE-1,1-DIOL × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；pH 7.00	Resolution 2.00 Å R-free 0.229
1H86 COVALENT ADDUCT BETWEEN POLYAMINE OXIDASE AND N1ethylN11((cycloheptyl)methyl)4,8diazaundecane at pH 7.0 Deposited 2001-01-24	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 29–500（472 aa）	Not recorded	FAD FLAVIN-ADENINE DINUCLEOTIDE × 2 NBA 3-[(3-{[3-(METHYLAMINO)PROPYL]AMINO}PROPYL)AMINO]PROPANE-1,1-DIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；pH 7.00	Resolution 2.00 Å R-free 0.229
3KPF X-ray structure of the mutant Lys300Met of polyamine oxidase from Zea mays Deposited 2009-11-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 29–500（472 aa）	Mutation：K300M	FAD FLAVIN-ADENINE DINUCLEOTIDE × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CL CHLORIDE ION × 1 ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；293 K；50% SATURATED AMMONIUM SULFATE SOLUTION, 0.1M SODIUM ACETATE pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.90 Å R-free 0.223
3KPF X-ray structure of the mutant Lys300Met of polyamine oxidase from Zea mays Deposited 2009-11-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain B 29–500（472 aa）	Mutation：K300M	FAD FLAVIN-ADENINE DINUCLEOTIDE × 1 ACT ACETATE ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；293 K；50% SATURATED AMMONIUM SULFATE SOLUTION, 0.1M SODIUM ACETATE pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.90 Å R-free 0.223
3KPF X-ray structure of the mutant Lys300Met of polyamine oxidase from Zea mays Deposited 2009-11-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 29–500（472 aa） Chain B 29–500（472 aa）	Mutation：K300M Mutation：K300M	FAD FLAVIN-ADENINE DINUCLEOTIDE × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CL CHLORIDE ION × 1 ACT ACETATE ION × 2 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；293 K；50% SATURATED AMMONIUM SULFATE SOLUTION, 0.1M SODIUM ACETATE pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.90 Å R-free 0.223
3L1R X-ray structure of the mutant lys300met of polyamine oxidase from zea mays in complex with spermidine Deposited 2009-12-14	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 29–500（472 aa）	Mutation：K300M	FAD FLAVIN-ADENINE DINUCLEOTIDE × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SPD SPERMIDINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；50% SATURATED AMMONIUM SULFATE SOLUTION, 0.1M SODIUM ACETATE PH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.20 Å R-free 0.216
3L1R X-ray structure of the mutant lys300met of polyamine oxidase from zea mays in complex with spermidine Deposited 2009-12-14	Different ligand/ion Different structure-quality metrics	Assembly 2 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain B 29–500（472 aa）	Mutation：K300M	FAD FLAVIN-ADENINE DINUCLEOTIDE × 1 SPD SPERMIDINE × 1 SO4 SULFATE ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；50% SATURATED AMMONIUM SULFATE SOLUTION, 0.1M SODIUM ACETATE PH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.20 Å R-free 0.216
3L1R X-ray structure of the mutant lys300met of polyamine oxidase from zea mays in complex with spermidine Deposited 2009-12-14	Different ligand/ion Different structure-quality metrics	Assembly 3 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 29–500（472 aa） Chain B 29–500（472 aa）	Mutation：K300M Mutation：K300M	FAD FLAVIN-ADENINE DINUCLEOTIDE × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SPD SPERMIDINE × 2 SO4 SULFATE ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；50% SATURATED AMMONIUM SULFATE SOLUTION, 0.1M SODIUM ACETATE PH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.20 Å R-free 0.216

8 other PDB entries and 22 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PAO_MAIZE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–472； UniProt 29–500 Author chain B； PDBConstruct 1–472； UniProt 29–500

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3ku9
Deposition date deposition_date	2009-11-27
Structure title title	X-ray structure of the mutant lys300met of polyamine oxidase from zea mays in complex with spermine
Keywords keywords	Polyamine oxidase, Flavoprotein, Disulfide bond, FAD, Glycoprotein, Oxidoreductase; OXIDOREDUCTASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	30.54 Å
Radius of gyration Rg (electron density) rg_electron	29.93 Å
Forward intensity I(0) i0	184630000.00
Molecular weight molecular_weight	108650.0 kDa
Excluded volume excluded_volume	135820 Å³
Envelope volume envelope_volume	158610 Å³
Hydration-shell volume shell_volume	43376 Å³
Envelope diameter envelope_diameter	116.0 Å
Shell Rg shell_rg	37.96 Å
Envelope Rg envelope_rg	30.11 Å
Shape Rg shape_rg	29.88 Å
Total Rg total_rg	30.76 Å
Total atoms total_atoms	7662
Residues n_residues	932
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	101.4 Å
Rg (real space) rg_real	30.49 Å
Rg uncertainty (real space) rg_real_error	0.83 Å
I(0) (real space) i0_real	1.8460e+08
I(0) uncertainty (real space) i0_real_error	2.6110e+06
Rg (reciprocal space) rg_reciprocal	30.51 Å
I(0) (reciprocal space) i0_reciprocal	184600000.0000
Solution quality estimate total_estimate	0.8047
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	3
Primary peak position r_peak_primary	37.1 Å
Skewness Skewness skewness	0.329
Kurtosis Kurtosis kurtosis	-0.343
Angular range angular_range	— – 0.2600 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	82970000.0000
Real-space data points n_real_points	53
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.822; Stabil: 0.998; Sysdev: 1.000; Positv: 1.000; Valcen: 0.996; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Polyamine oxidase
Molecular weight formula_weight	54529.3 kDa
EC 编号 ec_number	1.5.3.-
Mutation mutation	K300M
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	7758

ATVGPRVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAGINVELGANWVEGVNGGKMNPIWPIVNSTLKLRNFRSDFDYLAQNVYKEDGGVYDEDYVQKRIELADSVEEMGEKLSATLHASGRDDMSILAMQRLNEHQPNGPATPVDMVVDYYKFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVYYLAGQYLKTDDKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKPKLPTWKVRAIYQFDMAVYTMIFLKFPRKFWPEGKGREFFLYASSRRGYYGVWQEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPRWWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAEILINCAQKKMCKYHVQGKYDHHHHHH

来源 Source

来源生物 organism	Zea mays
通用名 common_name	maize
NCBI Class编号 ncbi_taxonomy_id	4577
宿主生物 host_organism	PICHIA PASTORIS

Entity 2 Entity 2 branched

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	424.4 kDa
Source method src_method	man
Copy count entity_count	1

Entity 3 Entity 3 non-polymer

Description description	FLAVIN-ADENINE DINUCLEOTIDE
Molecular weight formula_weight	785.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	man
Copy count entity_count	1

Entity 5 Entity 5 non-polymer

Description description	SPERMINE
Molecular weight formula_weight	202.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 6 Entity 6 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 7 Entity 7 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 8 Entity 8 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	53

▼

7. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	3ku9A01
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	50 — FAD/NAD(P)-binding domain
Homologous superfamily homologous superfamily	60 — FAD/NAD(P)-binding domain

Domain ID domain_id	3ku9A02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	660 — Polyamine Oxidase; Chain A, domain 2
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3ku9B01
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	50 — FAD/NAD(P)-binding domain
Homologous superfamily homologous superfamily	60 — FAD/NAD(P)-binding domain

Domain ID domain_id	3ku9B02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	660 — Polyamine Oxidase; Chain A, domain 2
Homologous superfamily homologous superfamily	10 —

▶

8. Citations (1)

▶

Unit-cell length a length_a	138.957 Å
Unit-cell length b length_b	138.957 Å
Unit-cell length c length_c	189.800 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 31 2 1
Space-group number int_tables_number	152
Crystal system crystal_system	—

Resolution resolution	3.200 Å
Low-resolution limit resolution_low	50.000 Å
R factor r_factor	0.1850
R_work r_work	0.1830
R_free r_free	0.2190

fit	/app/data/saxs_computation/ku/3ku9/3ku9.fit
pddf	/app/data/pr_computation/ku/3ku9/3ku9.pr.out
profile	/app/data/saxs_computation/ku/3ku9/3ku9.dat

X-ray structure of the mutant lys300met of polyamine oxidase from zea mays in complex with spermine