3l89

Human Adenovirus type 21 knob in complex with domains SCR1 and SCR2 of CD46 (membrane cofactor protein, MCP)

Method: X-RAY DIFFRACTION D_max: 208.0 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fiber protein

Human adenovirus 21

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain A； UniProt 123–323 Chain B； UniProt 123–323 Chain C； UniProt 123–323	Fragment：Ad21 fiber knob (UNP residues 123-323)	Membrane cofactor protein × 3 （P15529） NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 5.6；298 K；6% PEG 8000, 0.1M LiCl, pH 5.6, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.50 Å R-free 0.239
2	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain D； UniProt 123–323 Chain E； UniProt 123–323 Chain F； UniProt 123–323	Fragment：Ad21 fiber knob (UNP residues 123-323)	Membrane cofactor protein × 3 （P15529） NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 5.6；298 K；6% PEG 8000, 0.1M LiCl, pH 5.6, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.50 Å R-free 0.239
3	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain G； UniProt 123–323 Chain H； UniProt 123–323 Chain I； UniProt 123–323	Fragment：Ad21 fiber knob (UNP residues 123-323)	Membrane cofactor protein × 3 （P15529） NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 5.6；298 K；6% PEG 8000, 0.1M LiCl, pH 5.6, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.50 Å R-free 0.239
4	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain J； UniProt 123–323 Chain K； UniProt 123–323 Chain L； UniProt 123–323	Fragment：Ad21 fiber knob (UNP residues 123-323)	Membrane cofactor protein × 3 （P15529） NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 5.6；298 K；6% PEG 8000, 0.1M LiCl, pH 5.6, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.50 Å R-free 0.239

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 3L89	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3L88 Crystal structure of the human Adenovirus type 21 fiber knob Deposited 2009-12-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 123–323（201 aa） Fragment：Ad21 fiber knob (UNP residues 123-323) Chain B 123–323（201 aa） Fragment：Ad21 fiber knob (UNP residues 123-323) Chain C 123–323（201 aa） Fragment：Ad21 fiber knob (UNP residues 123-323)	Not recorded	NA SODIUM ION × 2 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.1；298 K；22% PEG 3000, 0.2 M NaCl, 0.1 M Tris, pH 7.1, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.50 Å R-free 0.259
3L88 Crystal structure of the human Adenovirus type 21 fiber knob Deposited 2009-12-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain D 123–323（201 aa） Fragment：Ad21 fiber knob (UNP residues 123-323) Chain E 123–323（201 aa） Fragment：Ad21 fiber knob (UNP residues 123-323) Chain F 123–323（201 aa） Fragment：Ad21 fiber knob (UNP residues 123-323)	Not recorded	NA SODIUM ION × 2 GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.1；298 K；22% PEG 3000, 0.2 M NaCl, 0.1 M Tris, pH 7.1, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.50 Å R-free 0.259
3L88 Crystal structure of the human Adenovirus type 21 fiber knob Deposited 2009-12-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain G 123–323（201 aa） Fragment：Ad21 fiber knob (UNP residues 123-323) Chain H 123–323（201 aa） Fragment：Ad21 fiber knob (UNP residues 123-323) Chain I 123–323（201 aa） Fragment：Ad21 fiber knob (UNP residues 123-323)	Not recorded	NA SODIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.1；298 K；22% PEG 3000, 0.2 M NaCl, 0.1 M Tris, pH 7.1, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.50 Å R-free 0.259
3L88 Crystal structure of the human Adenovirus type 21 fiber knob Deposited 2009-12-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain J 123–323（201 aa） Fragment：Ad21 fiber knob (UNP residues 123-323) Chain K 123–323（201 aa） Fragment：Ad21 fiber knob (UNP residues 123-323) Chain L 123–323（201 aa） Fragment：Ad21 fiber knob (UNP residues 123-323)	Not recorded	NA SODIUM ION × 5 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.1；298 K；22% PEG 3000, 0.2 M NaCl, 0.1 M Tris, pH 7.1, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.50 Å R-free 0.259

1 other PDB entries and 4 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q2KS96_9ADEN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–201； UniProt 123–323 Author chain B； PDBConstruct 1–201； UniProt 123–323 Author chain C； PDBConstruct 1–201； UniProt 123–323 Author chain D； PDBConstruct 1–201； UniProt 123–323 Author chain E； PDBConstruct 1–201； UniProt 123–323 Author chain F； PDBConstruct 1–201； UniProt 123–323 Author chain G； PDBConstruct 1–201； UniProt 123–323 Author chain H； PDBConstruct 1–201； UniProt 123–323 Author chain I； PDBConstruct 1–201； UniProt 123–323 Author chain J； PDBConstruct 1–201； UniProt 123–323 Author chain K； PDBConstruct 1–201； UniProt 123–323 Author chain L； PDBConstruct 1–201； UniProt 123–323

Membrane cofactor protein

Homo sapiens

UniProt P15529

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain M； UniProt 35–160 Chain N； UniProt 35–160 Chain O； UniProt 35–160	Fragment：CD46 SCR1 and SCR2 domains (UNP residues 35-160)	Fiber protein × 3 （Q2KS96） NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 5.6；298 K；6% PEG 8000, 0.1M LiCl, pH 5.6, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.50 Å R-free 0.239
2	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain P； UniProt 35–160 Chain Q； UniProt 35–160 Chain R； UniProt 35–160	Fragment：CD46 SCR1 and SCR2 domains (UNP residues 35-160)	Fiber protein × 3 （Q2KS96） NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 5.6；298 K；6% PEG 8000, 0.1M LiCl, pH 5.6, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.50 Å R-free 0.239
3	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain S； UniProt 35–160 Chain T； UniProt 35–160 Chain U； UniProt 35–160	Fragment：CD46 SCR1 and SCR2 domains (UNP residues 35-160)	Fiber protein × 3 （Q2KS96） NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 5.6；298 K；6% PEG 8000, 0.1M LiCl, pH 5.6, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.50 Å R-free 0.239
4	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain V； UniProt 35–160 Chain W； UniProt 35–160 Chain X； UniProt 35–160	Fragment：CD46 SCR1 and SCR2 domains (UNP residues 35-160)	Fiber protein × 3 （Q2KS96） NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 5.6；298 K；6% PEG 8000, 0.1M LiCl, pH 5.6, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.50 Å R-free 0.239

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 3L89	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1CKL N-TERMINAL TWO DOMAINS OF HUMAN CD46 (MEMBRANE COFACTOR PROTEIN, MCP) Deposited 1999-04-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 35–160（126 aa） Fragment：N-TERMINAL TWO SCR DOMAINS	Not recorded	CA CALCIUM ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；16% PEG 8000, 40 MM CACL2, 100 MM NA-CACODYLATE PH 6.5, 7 MG/ML PROTEIN, 20C, pH 6.50	Resolution 3.10 Å R-free 0.298
1CKL N-TERMINAL TWO DOMAINS OF HUMAN CD46 (MEMBRANE COFACTOR PROTEIN, MCP) Deposited 1999-04-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain B 35–160（126 aa） Fragment：N-TERMINAL TWO SCR DOMAINS	Not recorded	CA CALCIUM ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；16% PEG 8000, 40 MM CACL2, 100 MM NA-CACODYLATE PH 6.5, 7 MG/ML PROTEIN, 20C, pH 6.50	Resolution 3.10 Å R-free 0.298
1CKL N-TERMINAL TWO DOMAINS OF HUMAN CD46 (MEMBRANE COFACTOR PROTEIN, MCP) Deposited 1999-04-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain C 35–160（126 aa） Fragment：N-TERMINAL TWO SCR DOMAINS	Not recorded	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；16% PEG 8000, 40 MM CACL2, 100 MM NA-CACODYLATE PH 6.5, 7 MG/ML PROTEIN, 20C, pH 6.50	Resolution 3.10 Å R-free 0.298
1CKL N-TERMINAL TWO DOMAINS OF HUMAN CD46 (MEMBRANE COFACTOR PROTEIN, MCP) Deposited 1999-04-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain D 35–160（126 aa） Fragment：N-TERMINAL TWO SCR DOMAINS	Not recorded	CA CALCIUM ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；16% PEG 8000, 40 MM CACL2, 100 MM NA-CACODYLATE PH 6.5, 7 MG/ML PROTEIN, 20C, pH 6.50	Resolution 3.10 Å R-free 0.298
1CKL N-TERMINAL TWO DOMAINS OF HUMAN CD46 (MEMBRANE COFACTOR PROTEIN, MCP) Deposited 1999-04-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain E 35–160（126 aa） Fragment：N-TERMINAL TWO SCR DOMAINS	Not recorded	CA CALCIUM ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；16% PEG 8000, 40 MM CACL2, 100 MM NA-CACODYLATE PH 6.5, 7 MG/ML PROTEIN, 20C, pH 6.50	Resolution 3.10 Å R-free 0.298
1CKL N-TERMINAL TWO DOMAINS OF HUMAN CD46 (MEMBRANE COFACTOR PROTEIN, MCP) Deposited 1999-04-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain F 35–160（126 aa） Fragment：N-TERMINAL TWO SCR DOMAINS	Not recorded	CA CALCIUM ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；16% PEG 8000, 40 MM CACL2, 100 MM NA-CACODYLATE PH 6.5, 7 MG/ML PROTEIN, 20C, pH 6.50	Resolution 3.10 Å R-free 0.298
2O39 Human Adenovirus type 11 knob in complex with domains SCR1 and SCR2 of CD46 (membrane cofactor protein, MCP) Deposited 2006-12-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 35–160（126 aa） Fragment：SCR1 and SCR 2 domains	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；35% PEG 200, 200mM CaCl2, 100mM Tris, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.85 Å R-free 0.273
2O39 Human Adenovirus type 11 knob in complex with domains SCR1 and SCR2 of CD46 (membrane cofactor protein, MCP) Deposited 2006-12-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 35–160（126 aa） Fragment：SCR1 and SCR 2 domains	Not recorded	CA CALCIUM ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；35% PEG 200, 200mM CaCl2, 100mM Tris, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.85 Å R-free 0.273
3INB Structure of the measles virus hemagglutinin bound to the CD46 receptor Deposited 2009-08-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 35–160（126 aa） Fragment：Sushi domains 1 and 2, residues 35-160 Chain D 35–160（126 aa） Fragment：Sushi domains 1 and 2, residues 35-160	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；293 K；12% PEG-8000, 0.2 M Ammonium Sulphate 2% PEG-400, 1% 1,2,3 heptanetriol, 1 mM Sodium Tungstate, 0.1 M Mes, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.10 Å R-free 0.259
3O8E Structure of extracelllar portion of CD46 in complex with Adenovirus type 11 knob Deposited 2010-08-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 35–286（252 aa） Fragment：CD46 SCR1-SCR4 (UNP RESIDUES 35-286)	Not recorded	DTD DITHIANE DIOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8；298 K；microseeding, pH 8.0, VAPOR DIFFUSION, temperature 298K	Resolution 2.84 Å R-free 0.229
3O8E Structure of extracelllar portion of CD46 in complex with Adenovirus type 11 knob Deposited 2010-08-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 35–286（252 aa） Fragment：CD46 SCR1-SCR4 (UNP RESIDUES 35-286)	Not recorded	DTD DITHIANE DIOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8；298 K；microseeding, pH 8.0, VAPOR DIFFUSION, temperature 298K	Resolution 2.84 Å R-free 0.229
5FO8 Crystal Structure of Human Complement C3b in Complex with MCP (CCP1-4) Deposited 2015-11-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 35–286（252 aa） Fragment：CCP DOMAINS 1-4, UNP RESIDUES 35-286	Not recorded	EDO 1,2-ETHANEDIOL × 32	X-RAY DIFFRACTION X-ray crystallization conditions 100MM AMMONIUM CITRATE 7% PEG 3350 5MM GLUTATHIONE 50MM BIS-TRIS PROPANE, PH 6.5	Resolution 2.40 Å R-free 0.219
8QK3 Human Adenovirus type 11 fiber knob in complex with its cell receptors, Desmoglein-2 and CD46 Deposited 2023-09-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–392（392 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å

6 other PDB entries and 13 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	MCP_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain M； PDBConstruct 1–126； UniProt 35–160 Author chain N； PDBConstruct 1–126； UniProt 35–160 Author chain O； PDBConstruct 1–126； UniProt 35–160 Author chain P； PDBConstruct 1–126； UniProt 35–160 Author chain Q； PDBConstruct 1–126； UniProt 35–160 Author chain R； PDBConstruct 1–126； UniProt 35–160 Author chain S； PDBConstruct 1–126； UniProt 35–160 Author chain T； PDBConstruct 1–126； UniProt 35–160 Author chain U； PDBConstruct 1–126； UniProt 35–160 Author chain V； PDBConstruct 1–126； UniProt 35–160 Author chain W； PDBConstruct 1–126； UniProt 35–160 Author chain X； PDBConstruct 1–126； UniProt 35–160

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3l89
Deposition date deposition_date	2009-12-30
Structure title title	Human Adenovirus type 21 knob in complex with domains SCR1 and SCR2 of CD46 (membrane cofactor protein, MCP)
Keywords keywords	;Adenovirus, Fiber Knob, Viral Protein, Membrane cofactor protein, MCP, virus receptor complex, SCR, Short consensus repeat, CCP, complement control protein, Complement pathway, Glycoprotein, Host-virus interaction, Immune response, Innate immunity, Sushi2, VIRAL PROTEIN-PROTEIN BINDING complex ;; VIRAL PROTEIN/PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	60.36 Å
Radius of gyration Rg (electron density) rg_electron	59.96 Å
Forward intensity I(0) i0	2370490000.00
Molecular weight molecular_weight	412450.0 kDa
Excluded volume excluded_volume	515870 Å³
Envelope volume envelope_volume	786310 Å³
Hydration-shell volume shell_volume	108710 Å³
Envelope diameter envelope_diameter	209.6 Å
Shell Rg shell_rg	63.24 Å
Envelope Rg envelope_rg	57.83 Å
Shape Rg shape_rg	59.95 Å
Total Rg total_rg	60.05 Å
Total atoms total_atoms	29015
Residues n_residues	3713
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	208.0 Å
Rg (real space) rg_real	60.24 Å
Rg uncertainty (real space) rg_real_error	2.14 Å
I(0) (real space) i0_real	2.3700e+09
I(0) uncertainty (real space) i0_real_error	4.8690e+07
Rg (reciprocal space) rg_reciprocal	60.43 Å
I(0) (reciprocal space) i0_reciprocal	2371000000.0000
Solution quality estimate total_estimate	0.8800
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	72.0 Å
Skewness Skewness skewness	0.220
Kurtosis Kurtosis kurtosis	-0.437
Angular range angular_range	— – 0.1300 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	109400000.0000
Real-space data points n_real_points	27
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.860; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.982; Smooth: 0.875

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Fiber protein
Molecular weight formula_weight	22218.8 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L
Atom count atom_count	29017

GDICIKDSINTLWTGIKPPPNCQIVENTDTNDGKLTLVLVKNGGLVNGYVSLVGVSDTVNQMFTQKSATIQLRLYFDSSGNLLTDESNLKIPLKNKSSTATSEAATSSKAFMPSTTAYPFNTTTRDSENYIHGICYYMTSYDRSLVPLNISIMLNSRTISSNVAYAIQFEWNLNAKESPESNIATLTTSPFFFSYIREDDN

来源 Source

来源生物 organism	Human adenovirus 21
NCBI Class编号 ncbi_taxonomy_id	32608
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Membrane cofactor protein
Molecular weight formula_weight	14517.6 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,N,O,P,Q,R,S,T,U,V,W,X

CEEPPTFEAMELIGKPKPYYEIGERVDYKCKKGYFYIPPLATHTICDRNHTWLPVSDDACYRETCPYIRDPLNGQAVPANGTYEFGYQMHFICNEGYYLIGEEILYCELKGSVAIWSGKPPICEKV

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Cricetulus griseus

Entity 3 Entity 3 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	man
Copy count entity_count	4

▼

7. Fold Classification (SCOP + CATH) 36 domains

CATH v4.4 (36 domains)

Domain ID domain_id	3l89A00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	10 — Adenovirus pIV-related, attachment domain

Domain ID domain_id	3l89B00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	10 — Adenovirus pIV-related, attachment domain

Domain ID domain_id	3l89C00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	10 — Adenovirus pIV-related, attachment domain

Domain ID domain_id	3l89D00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	10 — Adenovirus pIV-related, attachment domain

Domain ID domain_id	3l89E00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	10 — Adenovirus pIV-related, attachment domain

Domain ID domain_id	3l89F00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	10 — Adenovirus pIV-related, attachment domain

Domain ID domain_id	3l89G00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	10 — Adenovirus pIV-related, attachment domain

Domain ID domain_id	3l89H00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	10 — Adenovirus pIV-related, attachment domain

Domain ID domain_id	3l89I00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	10 — Adenovirus pIV-related, attachment domain

Domain ID domain_id	3l89J00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	10 — Adenovirus pIV-related, attachment domain

Domain ID domain_id	3l89K00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	10 — Adenovirus pIV-related, attachment domain

Domain ID domain_id	3l89L00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	10 — Adenovirus pIV-related, attachment domain

Domain ID domain_id	3l89M01
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	3l89M02
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	3l89N01
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	3l89N02
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	3l89O01
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	3l89O02
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	3l89P01
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	3l89P02
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	3l89Q01
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	3l89Q02
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	3l89R01
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	3l89R02
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	3l89S01
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	3l89S02
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	3l89T01
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	3l89T02
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	3l89U01
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	3l89U02
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	3l89V01
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	3l89V02
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	3l89W01
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	3l89W02
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	3l89X01
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	3l89X02
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

▶

8. Citations (1)

▶

Unit-cell length a length_a	94.530 Å
Unit-cell length b length_b	107.710 Å
Unit-cell length c length_c	154.100 Å
Unit-cell angle α angle_alpha	90.01 °
Unit-cell angle β angle_beta	90.10 °
Unit-cell angle γ angle_gamma	104.70 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.500 Å
Low-resolution limit resolution_low	47.991 Å
R factor r_factor	0.2055
R_work r_work	0.2037
R_free r_free	0.2389

Human Adenovirus type 21 knob in complex with domains SCR1 and SCR2 of CD46 (membrane cofactor protein, MCP)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fiber protein

State in the Current Structure

Other States of the Same Protein in the Database

Membrane cofactor protein

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

7. Fold Classification (SCOP + CATH) 36 domains

CATH v4.4 (36 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)

fit	/app/data/saxs_computation/l8/3l89/3l89.fit
pddf	/app/data/pr_computation/l8/3l89/3l89.pr.out
profile	/app/data/saxs_computation/l8/3l89/3l89.dat