SAXSdb — 3m9d

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome-associated ATPase

Mycobacterium tuberculosis

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Prokaryotic ubiquitin-like protein pup × 3 （O33246）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 9	Prokaryotic ubiquitin-like protein pup × 3 （O33246）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MPA_MYCTU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–234； UniProt 1–234 Author chain B； PDBConstruct 1–234； UniProt 1–234 Author chain C； PDBConstruct 1–234； UniProt 1–234 Author chain D； PDBConstruct 1–234； UniProt 1–234 Author chain E； PDBConstruct 1–234； UniProt 1–234 Author chain F； PDBConstruct 1–234； UniProt 1–234 Author chain J； PDBConstruct 1–234； UniProt 1–234 Author chain K； PDBConstruct 1–234； UniProt 1–234 Author chain L； PDBConstruct 1–234； UniProt 1–234 Author chain M； PDBConstruct 1–234； UniProt 1–234 Author chain N； PDBConstruct 1–234； UniProt 1–234 Author chain O； PDBConstruct 1–234； UniProt 1–234

Prokaryotic ubiquitin-like protein pup

Mycobacterium tuberculosis

UniProt O33246

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Proteasome-associated ATPase × 6 （P63345）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 9	Proteasome-associated ATPase × 6 （P63345）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PUP_MYCTU
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain G； PDBConstruct 5–68； UniProt 1–64 Author chain H； PDBConstruct 5–68； UniProt 1–64 Author chain I； PDBConstruct 5–68； UniProt 1–64 Author chain P； PDBConstruct 5–68； UniProt 1–64 Author chain Q； PDBConstruct 5–68； UniProt 1–64 Author chain R； PDBConstruct 5–68； UniProt 1–64

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3m9d
Deposition date deposition_date	2010-03-22
Structure title title	Crystal structure of the prokaryotic ubiquintin-like protein Pup complexed with the hexameric proteasomal ATPase Mpa which includes the amino terminal coiled coil domain and the inter domain
Keywords keywords	;alpha helix coil coil, 5 beta-strand barrel, ATP-binding, Chaperone, Nucleotide-binding, Proteasome, S-nitrosylation, Virulence, Isopeptide bond, Ubl conjugation pathway ;; CHAPERONE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3m9d__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3m9d__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3m9d__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	40.86 Å
Rg (electron density)	40.48 Å
Total Rg	40.75 Å
Atom count	9318
Residues	1209
Excluded volume	164480 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3m9d__assembly_1__model_1`	nonameric （9）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3m9d__assembly_2__model_1`	nonameric （9）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Proteasome-associated ATPase
Molecular weight formula_weight	27491.8 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,J,K,L,M,N,O
Atom count atom_count	18636

MGESERSEAFGIPRDSPLSSGDAAELEQLRREAAVLREQLENAVGSHAPTRSARDIHQLEARIDSLAARNSKLMETLKEARQQLLALREEVDRLGQPPSGYGVLLATHDDDTVDVFTSGRKMRLTCSPNIDAASLKKGQTVRLNEALTVVEAGTFEAVGEISTLREILADGHRALVVGHADEERVVWLADPLIAEDLPDGLPEALNDDTRPRKLRPGDSLLVDTKAGYAFERIPLVPRGSAAALEHHHHHH

Source Source

Source organism organism	Mycobacterium tuberculosis
NCBI taxonomy ID ncbi_taxonomy_id	83332
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Prokaryotic ubiquitin-like protein pup
Molecular weight formula_weight	7365.7 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H,I,P,Q,R

GSHMMAQEQTKRGGGGGDDDDIAGSTAAGQERREKLTEETDDLLDEIDDVLEENAEDFVRAYVQKGGE

Source Source

Source organism organism	Mycobacterium tuberculosis
NCBI taxonomy ID ncbi_taxonomy_id	83332
Host organism host_organism	Escherichia coli

▶

Unit-cell length a length_a	176.580 Å
Unit-cell length b length_b	176.960 Å
Unit-cell length c length_c	176.610 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	89.94 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	4.500 Å
Low-resolution limit resolution_low	25.000 Å
R factor r_factor	0.2653
R_work r_work	0.2639
R_free r_free	0.2921

Crystal structure of the prokaryotic ubiquintin-like protein Pup complexed with the hexameric proteasomal ATPase Mpa which includes the amino terminal coiled coil domain and the inter domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome-associated ATPase

State in the Current Structure

Other States of the Same Protein in the Database

Prokaryotic ubiquitin-like protein pup

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3m9d__assembly_2__model_1

3m9d__assembly_2__model_1 | I(q)

3m9d__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)

Crystal structure of the prokaryotic ubiquintin-like protein Pup complexed with the hexameric proteasomal ATPase Mpa which includes the amino terminal coiled coil domain and the inter domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome-associated ATPase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Prokaryotic ubiquitin-like protein pup

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3m9d__assembly_2__model_1

3m9d__assembly_2__model_1 | I(q)

3m9d__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)