SAXSdb — 3n0s

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Aminoglycoside N3-acetyltransferase

Bacillus anthracis

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	ACETYL COENZYME *A × 2 MAGNESIUM ION × 1 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 water × 2	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	ACETYL COENZYME *A × 2 MAGNESIUM ION × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q81P86_BACAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–268； UniProt 1–265 Author chain B； PDBConstruct 4–268； UniProt 1–265 Author chain C； PDBConstruct 4–268； UniProt 1–265 Author chain D； PDBConstruct 4–268； UniProt 1–265

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3n0s
Deposition date deposition_date	2010-05-14
Structure title title	Crystal structure of BA2930 mutant (H183A) in complex with AcCoA
Keywords keywords	ACCOA, 2 ACYLTRANSFERASE, STRUCTURAL GENOMICS, CENTER FOR STRUCTURAL GENOMICS OF INFECTIOUS DISEASES, CSGID, TRANSFERASE; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3n0s__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3n0s__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3n0s__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	25.33 Å
Rg (electron density)	24.57 Å
Total Rg	25.25 Å
Atom count	4253
Residues	513
Excluded volume	75849 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3n0s__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3n0s__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Aminoglycoside N3-acetyltransferase
Molecular weight formula_weight	30270.1 kDa
EC 编号 ec_number	2.3.1.81
Mutation mutation	H183A
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D,C,B
Atom count atom_count	8881

SNAMNDIVASTQLPNTIKTITNDLRKLGLKKGMTVIVHSSLSSIGWISGGAVAVVEALMEVITEEGTIIMPTQSSDLSDPKHWSRPPVPEEWWQIIRDNVPAFEPHITPTRAMGKVVECFRTYPNVVRSNHPLGSFAAWGRHAEEITVNQSLSMSLGEESPLRKIYDLDGYILLIGVGYDSNTSVALSEVRSGACELIKVGAPIIENGERVWKEFVDMDYDSDKFVEIGVEFEQKGTVTMGKIGNAKCRLMKQRDIVDFGTEWFRKKN

Source Source

Source organism organism	Bacillus anthracis
NCBI taxonomy ID ncbi_taxonomy_id	198094
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	ACETYL COENZYME *A
Molecular weight formula_weight	809.6 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 3 Entity 3 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 non-polymer

Description description	4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID
Molecular weight formula_weight	238.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	374

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (8 domains)

Domain ID domain_id	d3n0sa1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.140 — TTHA0583/YokD-like
Superfamily Superfamily superfamily	c.140.1 — TTHA0583/YokD-like
Family Family family	c.140.1.0 — automated matches

Domain ID domain_id	d3n0sa2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3n0sb1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.140 — TTHA0583/YokD-like
Superfamily Superfamily superfamily	c.140.1 — TTHA0583/YokD-like
Family Family family	c.140.1.0 — automated matches

Domain ID domain_id	d3n0sb2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3n0sc1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.140 — TTHA0583/YokD-like
Superfamily Superfamily superfamily	c.140.1 — TTHA0583/YokD-like
Family Family family	c.140.1.0 — automated matches

Domain ID domain_id	d3n0sc2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3n0sd1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.140 — TTHA0583/YokD-like
Superfamily Superfamily superfamily	c.140.1 — TTHA0583/YokD-like
Family Family family	c.140.1.0 — automated matches

Domain ID domain_id	d3n0sd2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

▶

Unit-cell length a length_a	72.036 Å
Unit-cell length b length_b	109.441 Å
Unit-cell length c length_c	74.048 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	111.86 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.150 Å
Low-resolution limit resolution_low	50.000 Å
R factor r_factor	0.1758
R_work r_work	0.1730
R_free r_free	0.2279

Crystal structure of BA2930 mutant (H183A) in complex with AcCoA

1. Protein Identity and Related Structures Protein Identity & Related Structures

Aminoglycoside N3-acetyltransferase

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3n0s__assembly_1__model_1

3n0s__assembly_1__model_1 | I(q)

3n0s__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (8 domains)

7. Citations (1)

Crystal structure of BA2930 mutant (H183A) in complex with AcCoA

1. Protein Identity and Related Structures Protein Identity & Related Structures

Aminoglycoside N3-acetyltransferase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3n0s__assembly_1__model_1

3n0s__assembly_1__model_1 | I(q)

3n0s__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (8 domains)

7. Citations (1)