3n99

Crystal structure of TM1086

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

uncharacterized protein TM1086

Thermotoga maritima

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 10	CHLORIDE ION × 27 water × 10	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 10	CHLORIDE ION × 29 water × 10	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 10	CHLORIDE ION × 30 water × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9X0H2_THEMA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 9–290； UniProt 1–282 Author chain B； PDBConstruct 9–290； UniProt 1–282 Author chain C； PDBConstruct 9–290； UniProt 1–282 Author chain D； PDBConstruct 9–290； UniProt 1–282 Author chain E； PDBConstruct 9–290； UniProt 1–282 Author chain G； PDBConstruct 9–290； UniProt 1–282 Author chain H； PDBConstruct 9–290； UniProt 1–282 Author chain I； PDBConstruct 9–290； UniProt 1–282 Author chain J； PDBConstruct 9–290； UniProt 1–282 Author chain K； PDBConstruct 9–290； UniProt 1–282 Author chain L； PDBConstruct 9–290； UniProt 1–282 Author chain M； PDBConstruct 9–290； UniProt 1–282 Author chain N； PDBConstruct 9–290； UniProt 1–282 Author chain O； PDBConstruct 9–290； UniProt 1–282 Author chain P； PDBConstruct 9–290； UniProt 1–282 Author chain S； PDBConstruct 9–290； UniProt 1–282 Author chain T； PDBConstruct 9–290； UniProt 1–282 Author chain U； PDBConstruct 9–290； UniProt 1–282 Author chain V； PDBConstruct 9–290； UniProt 1–282 Author chain X； PDBConstruct 9–290； UniProt 1–282 Author chain a； PDBConstruct 9–290； UniProt 1–282 Author chain b； PDBConstruct 9–290； UniProt 1–282 Author chain c； PDBConstruct 9–290； UniProt 1–282 Author chain d； PDBConstruct 9–290； UniProt 1–282 Author chain e； PDBConstruct 9–290； UniProt 1–282 Author chain g； PDBConstruct 9–290； UniProt 1–282 Author chain h； PDBConstruct 9–290； UniProt 1–282 Author chain i； PDBConstruct 9–290； UniProt 1–282 Author chain j； PDBConstruct 9–290； UniProt 1–282 Author chain k； PDBConstruct 9–290； UniProt 1–282

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3n99
Deposition date deposition_date	2010-05-28
Structure title title	Crystal structure of TM1086
Keywords keywords	unknown function, structural genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG; structural genomics, unknown function
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3n99__assembly_3__model_1

Assembly 3 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3n99__assembly_3__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3n99__assembly_3__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	41.91 Å
Rg (electron density)	41.10 Å
Total Rg	41.46 Å
Atom count	21083
Residues	2825
Excluded volume	376800 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3n99__assembly_1__model_1`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3n99__assembly_2__model_1`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`3n99__assembly_3__model_1`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	uncharacterized protein TM1086
Molecular weight formula_weight	31106.7 kDa
Source method src_method	man
Copy count entity_count	30

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,G,H,I,J,K,L,M,N,O,P,S,T,U,V,X,a,b,c,d,e,g,h,i,j,k
Atom count atom_count	68631

HHHHHHGHMRTNKDRLVRISVVGEIAPAKMRSPYSVTTEGTVRVIPVLGGITYNVKVGDSAYGWAGDHVEPGVSVMARRKEEEIPLMTLSCIGNEVIVMSGDAKGSRGFVTGKHGGVNHVLVHFEEEVLGKLMVGDKILIKAWGQGLKLLDHPDVKVMNIDPDLFEKLGIQEKNGKIHVPVVAKIPAHMMGSGIGASSSASTDYDIMASNPEDLGVADLKLGDIVAIQDHDNSYGVGKYRKGAVSIGVVVHSACVSAGHGPGVVVIMTGDESKILPEEVERANISDYLVR

Source Source

Source organism organism	Thermotoga maritima
NCBI taxonomy ID ncbi_taxonomy_id	2336
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	86

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	5054

▼

6. Fold Classification (SCOP + CATH) 90 domains

CATH v4.4 (90 domains)

Domain ID domain_id	3n99A01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	30 — tm1086 (SG structure) fold
Homologous superfamily homologous superfamily	10 — tm1086 (SG structure) domain

Domain ID domain_id	3n99A02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	3n99A03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1180 — tm1086 fold
Homologous superfamily homologous superfamily	10 — tm1086 domain

Domain ID domain_id	3n99B01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	30 — tm1086 (SG structure) fold
Homologous superfamily homologous superfamily	10 — tm1086 (SG structure) domain

Domain ID domain_id	3n99B02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	3n99B03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1180 — tm1086 fold
Homologous superfamily homologous superfamily	10 — tm1086 domain

Domain ID domain_id	3n99C01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	30 — tm1086 (SG structure) fold
Homologous superfamily homologous superfamily	10 — tm1086 (SG structure) domain

Domain ID domain_id	3n99C02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	3n99C03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1180 — tm1086 fold
Homologous superfamily homologous superfamily	10 — tm1086 domain

Domain ID domain_id	3n99D01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	30 — tm1086 (SG structure) fold
Homologous superfamily homologous superfamily	10 — tm1086 (SG structure) domain

Domain ID domain_id	3n99D02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	3n99D03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1180 — tm1086 fold
Homologous superfamily homologous superfamily	10 — tm1086 domain

Domain ID domain_id	3n99E01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	30 — tm1086 (SG structure) fold
Homologous superfamily homologous superfamily	10 — tm1086 (SG structure) domain

Domain ID domain_id	3n99E02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	3n99E03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1180 — tm1086 fold
Homologous superfamily homologous superfamily	10 — tm1086 domain

Domain ID domain_id	3n99G01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	30 — tm1086 (SG structure) fold
Homologous superfamily homologous superfamily	10 — tm1086 (SG structure) domain

Domain ID domain_id	3n99G02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	3n99G03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1180 — tm1086 fold
Homologous superfamily homologous superfamily	10 — tm1086 domain

Domain ID domain_id	3n99H01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	30 — tm1086 (SG structure) fold
Homologous superfamily homologous superfamily	10 — tm1086 (SG structure) domain

Domain ID domain_id	3n99H02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	3n99H03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1180 — tm1086 fold
Homologous superfamily homologous superfamily	10 — tm1086 domain

Domain ID domain_id	3n99I01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	30 — tm1086 (SG structure) fold
Homologous superfamily homologous superfamily	10 — tm1086 (SG structure) domain

Domain ID domain_id	3n99I02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	3n99I03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1180 — tm1086 fold
Homologous superfamily homologous superfamily	10 — tm1086 domain

Domain ID domain_id	3n99J01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	30 — tm1086 (SG structure) fold
Homologous superfamily homologous superfamily	10 — tm1086 (SG structure) domain

Domain ID domain_id	3n99J02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	3n99J03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1180 — tm1086 fold
Homologous superfamily homologous superfamily	10 — tm1086 domain

Domain ID domain_id	3n99K01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	30 — tm1086 (SG structure) fold
Homologous superfamily homologous superfamily	10 — tm1086 (SG structure) domain

Domain ID domain_id	3n99K02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	3n99K03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1180 — tm1086 fold
Homologous superfamily homologous superfamily	10 — tm1086 domain

Domain ID domain_id	3n99L01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	30 — tm1086 (SG structure) fold
Homologous superfamily homologous superfamily	10 — tm1086 (SG structure) domain

Domain ID domain_id	3n99L02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	3n99L03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1180 — tm1086 fold
Homologous superfamily homologous superfamily	10 — tm1086 domain

Domain ID domain_id	3n99M01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	30 — tm1086 (SG structure) fold
Homologous superfamily homologous superfamily	10 — tm1086 (SG structure) domain

Domain ID domain_id	3n99M02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	3n99M03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1180 — tm1086 fold
Homologous superfamily homologous superfamily	10 — tm1086 domain

Domain ID domain_id	3n99N01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	30 — tm1086 (SG structure) fold
Homologous superfamily homologous superfamily	10 — tm1086 (SG structure) domain

Domain ID domain_id	3n99N02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	3n99N03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1180 — tm1086 fold
Homologous superfamily homologous superfamily	10 — tm1086 domain

Domain ID domain_id	3n99O01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	30 — tm1086 (SG structure) fold
Homologous superfamily homologous superfamily	10 — tm1086 (SG structure) domain

Domain ID domain_id	3n99O02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	3n99O03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1180 — tm1086 fold
Homologous superfamily homologous superfamily	10 — tm1086 domain

Domain ID domain_id	3n99P01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	30 — tm1086 (SG structure) fold
Homologous superfamily homologous superfamily	10 — tm1086 (SG structure) domain

Domain ID domain_id	3n99P02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	3n99P03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1180 — tm1086 fold
Homologous superfamily homologous superfamily	10 — tm1086 domain

Domain ID domain_id	3n99S01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	30 — tm1086 (SG structure) fold
Homologous superfamily homologous superfamily	10 — tm1086 (SG structure) domain

Domain ID domain_id	3n99S02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	3n99S03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1180 — tm1086 fold
Homologous superfamily homologous superfamily	10 — tm1086 domain

Domain ID domain_id	3n99T01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	30 — tm1086 (SG structure) fold
Homologous superfamily homologous superfamily	10 — tm1086 (SG structure) domain

Domain ID domain_id	3n99T02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	3n99T03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1180 — tm1086 fold
Homologous superfamily homologous superfamily	10 — tm1086 domain

Domain ID domain_id	3n99U01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	30 — tm1086 (SG structure) fold
Homologous superfamily homologous superfamily	10 — tm1086 (SG structure) domain

Domain ID domain_id	3n99U02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	3n99U03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1180 — tm1086 fold
Homologous superfamily homologous superfamily	10 — tm1086 domain

Domain ID domain_id	3n99V01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	30 — tm1086 (SG structure) fold
Homologous superfamily homologous superfamily	10 — tm1086 (SG structure) domain

Domain ID domain_id	3n99V02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	3n99V03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1180 — tm1086 fold
Homologous superfamily homologous superfamily	10 — tm1086 domain

Domain ID domain_id	3n99X01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	30 — tm1086 (SG structure) fold
Homologous superfamily homologous superfamily	10 — tm1086 (SG structure) domain

Domain ID domain_id	3n99X02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	3n99X03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1180 — tm1086 fold
Homologous superfamily homologous superfamily	10 — tm1086 domain

Domain ID domain_id	3n99a01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	30 — tm1086 (SG structure) fold
Homologous superfamily homologous superfamily	10 — tm1086 (SG structure) domain

Domain ID domain_id	3n99a02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	3n99a03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1180 — tm1086 fold
Homologous superfamily homologous superfamily	10 — tm1086 domain

Domain ID domain_id	3n99b01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	30 — tm1086 (SG structure) fold
Homologous superfamily homologous superfamily	10 — tm1086 (SG structure) domain

Domain ID domain_id	3n99b02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	3n99b03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1180 — tm1086 fold
Homologous superfamily homologous superfamily	10 — tm1086 domain

Domain ID domain_id	3n99c01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	30 — tm1086 (SG structure) fold
Homologous superfamily homologous superfamily	10 — tm1086 (SG structure) domain

Domain ID domain_id	3n99c02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	3n99c03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1180 — tm1086 fold
Homologous superfamily homologous superfamily	10 — tm1086 domain

Domain ID domain_id	3n99d01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	30 — tm1086 (SG structure) fold
Homologous superfamily homologous superfamily	10 — tm1086 (SG structure) domain

Domain ID domain_id	3n99d02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	3n99d03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1180 — tm1086 fold
Homologous superfamily homologous superfamily	10 — tm1086 domain

Domain ID domain_id	3n99e01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	30 — tm1086 (SG structure) fold
Homologous superfamily homologous superfamily	10 — tm1086 (SG structure) domain

Domain ID domain_id	3n99e02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	3n99e03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1180 — tm1086 fold
Homologous superfamily homologous superfamily	10 — tm1086 domain

Domain ID domain_id	3n99g01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	30 — tm1086 (SG structure) fold
Homologous superfamily homologous superfamily	10 — tm1086 (SG structure) domain

Domain ID domain_id	3n99g02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	3n99g03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1180 — tm1086 fold
Homologous superfamily homologous superfamily	10 — tm1086 domain

Domain ID domain_id	3n99h01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	30 — tm1086 (SG structure) fold
Homologous superfamily homologous superfamily	10 — tm1086 (SG structure) domain

Domain ID domain_id	3n99h02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	3n99h03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1180 — tm1086 fold
Homologous superfamily homologous superfamily	10 — tm1086 domain

Domain ID domain_id	3n99i01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	30 — tm1086 (SG structure) fold
Homologous superfamily homologous superfamily	10 — tm1086 (SG structure) domain

Domain ID domain_id	3n99i02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	3n99i03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1180 — tm1086 fold
Homologous superfamily homologous superfamily	10 — tm1086 domain

Domain ID domain_id	3n99j01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	30 — tm1086 (SG structure) fold
Homologous superfamily homologous superfamily	10 — tm1086 (SG structure) domain

Domain ID domain_id	3n99j02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	3n99j03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1180 — tm1086 fold
Homologous superfamily homologous superfamily	10 — tm1086 domain

Domain ID domain_id	3n99k01
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	30 — tm1086 (SG structure) fold
Homologous superfamily homologous superfamily	10 — tm1086 (SG structure) domain

Domain ID domain_id	3n99k02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	3n99k03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1180 — tm1086 fold
Homologous superfamily homologous superfamily	10 — tm1086 domain

▶

Unit-cell length a length_a	289.839 Å
Unit-cell length b length_b	299.521 Å
Unit-cell length c length_c	316.013 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	240

Space group space_group	I 2 2 2
Space-group number int_tables_number	23
Crystal system crystal_system	—

Resolution resolution	2.380 Å
Low-resolution limit resolution_low	50.000 Å
R factor r_factor	0.1534
R_work r_work	0.1514
R_free r_free	0.1913

Crystal structure of TM1086

1. Protein Identity and Related Structures Protein Identity & Related Structures

uncharacterized protein TM1086

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3n99__assembly_3__model_1

3n99__assembly_3__model_1 | I(q)

3n99__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 90 domains

CATH v4.4 (90 domains)

7. Citations (1)

Crystal structure of TM1086

1. Protein Identity and Related Structures Protein Identity & Related Structures

uncharacterized protein TM1086

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3n99__assembly_3__model_1

3n99__assembly_3__model_1 | I(q)

3n99__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 90 domains

CATH v4.4 (90 domains)

7. Citations (1)