SAXSdb — 3osl

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Carboxypeptidase B2

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Carboxypeptidase inhibitor × 1 （Q5EPH2） ZINC ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Carboxypeptidase inhibitor × 1 （Q5EPH2） ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CBPB2_BOVIN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–401； UniProt 23–423 Author chain C； PDBConstruct 1–401； UniProt 23–423

Carboxypeptidase inhibitor

Rhipicephalus bursa

UniProt Q5EPH2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Carboxypeptidase B2 × 1 （Q2KIG3） ZINC ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Carboxypeptidase B2 × 1 （Q2KIG3） ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCI1_RHIBU
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–74； UniProt 23–96 Author chain D； PDBConstruct 1–74； UniProt 23–96

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3osl
Deposition date deposition_date	2010-09-09
Structure title title	Structure of bovine thrombin-activatable fibrinolysis inhibitor in complex with tick carboxypeptidase inhibitor
Keywords keywords	alpha/beta-hydrolase-related fold, Blood, fibrinolysis, coagulation, HYDROLASE-HYDROLASE INHIBITOR complex; HYDROLASE/HYDROLASE INHIBITOR
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3osl__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3osl__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3osl__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	20.76 Å
Rg (electron density)	19.63 Å
Total Rg	20.66 Å
Atom count	2968
Residues	370
Excluded volume	52638 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3osl__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3osl__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Carboxypeptidase B2
Molecular weight formula_weight	46534.8 kDa
EC 编号 ec_number	3.4.17.20
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	5980

FQRGQVLSALPRTSRQVQILQNVTTTYKIVLWQPVAAEYIVKGYEVHFFVNASDVSNVKAHLNASRIPFRVLVENVEDLIRQQTSNDTISPRASSSYYEQYHSLNEIYSWIEVMTERYPDMVEKIHIGSSYEKYPLYVLKVSKKEQRAKNAMWIDCGIHAREWISPAFCLWFVGSVTYYYGKEKMHTNLLKHMDFYIMPVVNVDGYDYTWKKDRMWRKNRSLHEKNACVGTDLNRNFASKHWCGEGASSSSCSEIYCGTYPESEPEVKAVADFLRRNIKHIKAYISMHSYSQKIVFPYSYSRSRSKDHEELSLVAREAVFAMENIHRNIRYTHGSGSESLYLAPGGSDDWIYDLGIKYSFTFELRDKGKYGFLLPESYIRPTCSEALVAVAKIASHVVKNV

Entity 2 Entity 2 polymer

Description description	Carboxypeptidase inhibitor
Molecular weight formula_weight	7807.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

NECVSKGFGCLPQSDCPQEARLSYGGCSTVCCDLSKLTGCKGKGGECNPLDRQCKELQAESASCGKGQKCCVWL

Source Source

Source organism organism	Rhipicephalus bursa
Common name common_name	Tick
NCBI taxonomy ID ncbi_taxonomy_id	67831
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Unit-cell length a length_a	279.100 Å
Unit-cell length b length_b	279.100 Å
Unit-cell length c length_c	279.100 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	48

Space group space_group	P 41 3 2
Space-group number int_tables_number	213
Crystal system crystal_system	—

Resolution resolution	6.000 Å
Low-resolution limit resolution_low	50.000 Å
R factor r_factor	0.3131
R_work r_work	0.3125
R_free r_free	0.3204

Structure of bovine thrombin-activatable fibrinolysis inhibitor in complex with tick carboxypeptidase inhibitor

1. Protein Identity and Related Structures Protein Identity & Related Structures

Carboxypeptidase B2

State in the Current Structure

Other States of the Same Protein in the Database

Carboxypeptidase inhibitor

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3osl__assembly_2__model_1

3osl__assembly_2__model_1 | I(q)

3osl__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

7. Citations (3)

Structure of bovine thrombin-activatable fibrinolysis inhibitor in complex with tick carboxypeptidase inhibitor

1. Protein Identity and Related Structures Protein Identity & Related Structures

Carboxypeptidase B2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Carboxypeptidase inhibitor

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3osl__assembly_2__model_1

3osl__assembly_2__model_1 | I(q)

3osl__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

7. Citations (3)