3qaz

IL-2 mutant D10 ternary complex

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Interleukin-2

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 receptor subunit beta × 1 （P14784） Cytokine receptor common subunit gamma × 1 （P31785） 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	Consistent with protein count
10	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 receptor subunit beta × 1 （P14784） Cytokine receptor common subunit gamma × 1 （P31785） 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	Consistent with protein count
11	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 receptor subunit beta × 1 （P14784） Cytokine receptor common subunit gamma × 1 （P31785） 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	Consistent with protein count
12	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 receptor subunit beta × 1 （P14784） Cytokine receptor common subunit gamma × 1 （P31785） 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 receptor subunit beta × 1 （P14784） Cytokine receptor common subunit gamma × 1 （P31785） 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 receptor subunit beta × 1 （P14784） Cytokine receptor common subunit gamma × 1 （P31785） 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 receptor subunit beta × 1 （P14784） Cytokine receptor common subunit gamma × 1 （P31785） 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 receptor subunit beta × 1 （P14784） Cytokine receptor common subunit gamma × 1 （P31785） 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 receptor subunit beta × 1 （P14784） Cytokine receptor common subunit gamma × 1 （P31785） 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 receptor subunit beta × 1 （P14784） Cytokine receptor common subunit gamma × 1 （P31785） 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 receptor subunit beta × 1 （P14784） Cytokine receptor common subunit gamma × 1 （P31785） 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	Consistent with protein count
9	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 receptor subunit beta × 1 （P14784） Cytokine receptor common subunit gamma × 1 （P31785） 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	IL2_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–136； UniProt 21–153 Author chain D； PDBConstruct 4–136； UniProt 21–153 Author chain G； PDBConstruct 4–136； UniProt 21–153 Author chain J； PDBConstruct 4–136； UniProt 21–153 Author chain M； PDBConstruct 4–136； UniProt 21–153 Author chain P； PDBConstruct 4–136； UniProt 21–153 Author chain S； PDBConstruct 4–136； UniProt 21–153 Author chain V； PDBConstruct 4–136； UniProt 21–153 Author chain Y； PDBConstruct 4–136； UniProt 21–153 Author chain b； PDBConstruct 4–136； UniProt 21–153 Author chain e； PDBConstruct 4–136； UniProt 21–153 Author chain h； PDBConstruct 4–136； UniProt 21–153

Interleukin-2 receptor subunit beta

Homo sapiens

UniProt P14784

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 × 1 （P60568） Cytokine receptor common subunit gamma × 1 （P31785） 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	Consistent with protein count
10	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 × 1 （P60568） Cytokine receptor common subunit gamma × 1 （P31785） 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	Consistent with protein count
11	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 × 1 （P60568） Cytokine receptor common subunit gamma × 1 （P31785） 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	Consistent with protein count
12	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 × 1 （P60568） Cytokine receptor common subunit gamma × 1 （P31785） 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 × 1 （P60568） Cytokine receptor common subunit gamma × 1 （P31785） 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 × 1 （P60568） Cytokine receptor common subunit gamma × 1 （P31785） 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 × 1 （P60568） Cytokine receptor common subunit gamma × 1 （P31785） 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 × 1 （P60568） Cytokine receptor common subunit gamma × 1 （P31785） 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 × 1 （P60568） Cytokine receptor common subunit gamma × 1 （P31785） 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 × 1 （P60568） Cytokine receptor common subunit gamma × 1 （P31785） 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 × 1 （P60568） Cytokine receptor common subunit gamma × 1 （P31785） 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	Consistent with protein count
9	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 × 1 （P60568） Cytokine receptor common subunit gamma × 1 （P31785） 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	IL2RB_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–217； UniProt 24–240 Author chain E； PDBConstruct 1–217； UniProt 24–240 Author chain H； PDBConstruct 1–217； UniProt 24–240 Author chain K； PDBConstruct 1–217； UniProt 24–240 Author chain N； PDBConstruct 1–217； UniProt 24–240 Author chain Q； PDBConstruct 1–217； UniProt 24–240 Author chain T； PDBConstruct 1–217； UniProt 24–240 Author chain W； PDBConstruct 1–217； UniProt 24–240 Author chain Z； PDBConstruct 1–217； UniProt 24–240 Author chain c； PDBConstruct 1–217； UniProt 24–240 Author chain f； PDBConstruct 1–217； UniProt 24–240 Author chain i； PDBConstruct 1–217； UniProt 24–240

Cytokine receptor common subunit gamma

Homo sapiens

UniProt P31785

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 × 1 （P60568） Interleukin-2 receptor subunit beta × 1 （P14784） 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	Consistent with protein count
10	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 × 1 （P60568） Interleukin-2 receptor subunit beta × 1 （P14784） 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	Consistent with protein count
11	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 × 1 （P60568） Interleukin-2 receptor subunit beta × 1 （P14784） 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	Consistent with protein count
12	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 × 1 （P60568） Interleukin-2 receptor subunit beta × 1 （P14784） 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 × 1 （P60568） Interleukin-2 receptor subunit beta × 1 （P14784） 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 × 1 （P60568） Interleukin-2 receptor subunit beta × 1 （P14784） 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 × 1 （P60568） Interleukin-2 receptor subunit beta × 1 （P14784） 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 × 1 （P60568） Interleukin-2 receptor subunit beta × 1 （P14784） 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 × 1 （P60568） Interleukin-2 receptor subunit beta × 1 （P14784） 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 × 1 （P60568） Interleukin-2 receptor subunit beta × 1 （P14784） 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 × 1 （P60568） Interleukin-2 receptor subunit beta × 1 （P14784） 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	Consistent with protein count
9	Protein heterocomplex	Heteromer	Protein 3	Interleukin-2 × 1 （P60568） Interleukin-2 receptor subunit beta × 1 （P14784） 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	IL2RG_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 4–202； UniProt 56–254 Author chain F； PDBConstruct 4–202； UniProt 56–254 Author chain I； PDBConstruct 4–202； UniProt 56–254 Author chain L； PDBConstruct 4–202； UniProt 56–254 Author chain O； PDBConstruct 4–202； UniProt 56–254 Author chain R； PDBConstruct 4–202； UniProt 56–254 Author chain U； PDBConstruct 4–202； UniProt 56–254 Author chain X； PDBConstruct 4–202； UniProt 56–254 Author chain a； PDBConstruct 4–202； UniProt 56–254 Author chain d； PDBConstruct 4–202； UniProt 56–254 Author chain g； PDBConstruct 4–202； UniProt 56–254 Author chain j； PDBConstruct 4–202； UniProt 56–254

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3qaz
Deposition date deposition_date	2011-01-12
Structure title title	IL-2 mutant D10 ternary complex
Keywords keywords	cytokine receptor signaling complex, SIGNALING PROTEIN-Cytokine complex; SIGNALING PROTEIN/Cytokine
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3qaz__assembly_7__model_1

Assembly 7 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3qaz__assembly_7__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3qaz__assembly_7__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	28.54 Å
Rg (electron density)	27.64 Å
Total Rg	28.39 Å
Atom count	4288
Residues	508
Excluded volume	76146 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3qaz__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3qaz__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`3qaz__assembly_3__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`3qaz__assembly_4__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`3qaz__assembly_5__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`3qaz__assembly_6__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
7	1	`3qaz__assembly_7__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
8	1	`3qaz__assembly_8__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
9	1	`3qaz__assembly_9__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
10	1	`3qaz__assembly_10__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
11	1	`3qaz__assembly_11__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
12	1	`3qaz__assembly_12__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Interleukin-2
Molecular weight formula_weight	15727.2 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D,G,J,M,P,S,V,Y,b,e,h
Atom count atom_count	51562

ADPAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAHSKNFHFDPRDVVSNINVFVLELKGSETTFMCEYADETATIVEFLNRWITFCQSIISTLT

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 2 Entity 2 polymer

Description description	Interleukin-2 receptor subunit beta
Molecular weight formula_weight	25044.4 kDa
Mutation mutation	N29Q, N43Q, N71Q
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,E,H,K,N,Q,T,W,Z,c,f,i

ADPAVQGTSQFTCFYNSRAQISCVWSQDGALQDTSCQVHAWPDRRRWQQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQDFKPFENLRLMAPISLQVVHVETHRCNISWEISQASHYFERHLEFEARTLSPGHTWEEAPLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTTWSPWSQPLAFRTKPAALGKDT

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 3 Entity 3 polymer

Description description	Cytokine receptor common subunit gamma
Molecular weight formula_weight	24196.0 kDa
Mutation mutation	N75Q
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,F,I,L,O,R,U,X,a,d,g,j

ADPPLPEVQCFVFNVEYMNCTWQSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 4 Entity 4 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	syn
Copy count entity_count	54

▼

6. Fold Classification (SCOP + CATH) 60 domains

CATH v4.4 (60 domains)

Domain ID domain_id	3qazA00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1250 — Growth Hormone; Chain: A;
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3qazB01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazB02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazC01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazC02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazD00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1250 — Growth Hormone; Chain: A;
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3qazE01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazE02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazF01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazF02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazG00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1250 — Growth Hormone; Chain: A;
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3qazH01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazH02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazI01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazI02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazJ00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1250 — Growth Hormone; Chain: A;
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3qazK01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazK02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazL01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazL02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazM00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1250 — Growth Hormone; Chain: A;
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3qazN01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazN02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazO01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazO02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazP00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1250 — Growth Hormone; Chain: A;
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3qazQ01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazQ02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazR01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazR02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazS00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1250 — Growth Hormone; Chain: A;
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3qazT01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazT02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazU01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazU02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazV00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1250 — Growth Hormone; Chain: A;
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3qazW01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazW02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazX01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazX02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazY00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1250 — Growth Hormone; Chain: A;
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3qazZ01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazZ02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qaza01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qaza02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazb00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1250 — Growth Hormone; Chain: A;
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3qazc01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazc02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazd01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazd02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qaze00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1250 — Growth Hormone; Chain: A;
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3qazf01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazf02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazg01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazg02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazh00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1250 — Growth Hormone; Chain: A;
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3qazi01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazi02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazj01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	3qazj02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

▶

Unit-cell length a length_a	118.226 Å
Unit-cell length b length_b	118.099 Å
Unit-cell length c length_c	236.115 Å
Unit-cell angle α angle_alpha	99.86 °
Unit-cell angle β angle_beta	99.86 °
Unit-cell angle γ angle_gamma	99.74 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.802 Å
Low-resolution limit resolution_low	52.191 Å
R factor r_factor	0.2920
R_work r_work	0.2910
R_free r_free	0.3440

IL-2 mutant D10 ternary complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Interleukin-2

State in the Current Structure

Other States of the Same Protein in the Database

Interleukin-2 receptor subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Cytokine receptor common subunit gamma

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3qaz__assembly_7__model_1

3qaz__assembly_7__model_1 | I(q)

3qaz__assembly_7__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

6. Fold Classification (SCOP + CATH) 60 domains

CATH v4.4 (60 domains)

7. Citations (1)

IL-2 mutant D10 ternary complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Interleukin-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Interleukin-2 receptor subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytokine receptor common subunit gamma

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3qaz__assembly_7__model_1

3qaz__assembly_7__model_1 | I(q)

3qaz__assembly_7__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

6. Fold Classification (SCOP + CATH) 60 domains

CATH v4.4 (60 domains)

7. Citations (1)