SAXSdb — 3qy2

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cyclin-dependent kinases regulatory subunit

Saccharomyces cerevisiae

UniProt P20486

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	CITRATE ANION × 1 water × 1	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 4	CITRATE ANION × 2 water × 4	Consistent with protein count
4	Protein homooligomer	Homooligomer	Protein 4	CITRATE ANION × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CKS1_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–117； UniProt 1–117 Author chain B； PDBConstruct 1–117； UniProt 1–117

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3qy2
Deposition date deposition_date	2011-03-02
Structure title title	Crystal structure of the P93A monomer mutant of S. cerevisiae Cks1
Keywords keywords	;protein kinase activator, ubiquitin binding, transcription, Cdc28 kinase, cell cycle, cyclin-dependent kinase, TRANSFERASE REGULATOR ;; TRANSFERASE REGULATOR
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3qy2__assembly_3__model_1

Assembly 3 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3qy2__assembly_3__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3qy2__assembly_3__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	27.98 Å
Rg (electron density)	27.94 Å
Total Rg	28.59 Å
Atom count	3574
Residues	420
Excluded volume	62791 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3qy2__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3qy2__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`3qy2__assembly_3__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`3qy2__assembly_4__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Cyclin-dependent kinases regulatory subunit
Molecular weight formula_weight	13847.5 kDa
Mutation mutation	P93A
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	1829

MYHHYHAFQGRKLTDQERARVLEFQDSIHYSPRYSDDNYEYRHVMLPKAMLKVIPSDYFNSEVGTLRILTEDEWRGLGITQSLGWEHYECHAAEPHILLFKRPLNYEAELRAATAAA

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast,lager beer yeast,yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	CITRATE ANION
Molecular weight formula_weight	189.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	42

▼

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d3qy2a_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.97 — Cell cycle regulatory proteins
Superfamily Superfamily superfamily	d.97.1 — Cell cycle regulatory proteins
Family Family family	d.97.1.1 — Cell cycle regulatory proteins

Domain ID domain_id	d3qy2b_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.97 — Cell cycle regulatory proteins
Superfamily Superfamily superfamily	d.97.1 — Cell cycle regulatory proteins
Family Family family	d.97.1.1 — Cell cycle regulatory proteins

CATH v4.4 (2 domains)

Domain ID domain_id	3qy2A00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	170 — Cyclin-Dependent Kinase Subunit Type 2
Homologous superfamily homologous superfamily	10 — Cyclin-dependent kinase, regulatory subunit

Domain ID domain_id	3qy2B00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	170 — Cyclin-Dependent Kinase Subunit Type 2
Homologous superfamily homologous superfamily	10 — Cyclin-dependent kinase, regulatory subunit

▶

Unit-cell length a length_a	89.522 Å
Unit-cell length b length_b	89.522 Å
Unit-cell length c length_c	93.157 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 43 21 2
Space-group number int_tables_number	96
Crystal system crystal_system	—

Resolution resolution	2.590 Å
Low-resolution limit resolution_low	64.550 Å
R factor r_factor	0.2174
R_work r_work	0.2115
R_free r_free	0.2729

Crystal structure of the P93A monomer mutant of S. cerevisiae Cks1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cyclin-dependent kinases regulatory subunit

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3qy2__assembly_3__model_1

3qy2__assembly_3__model_1 | I(q)

3qy2__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)

Crystal structure of the P93A monomer mutant of S. cerevisiae Cks1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cyclin-dependent kinases regulatory subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3qy2__assembly_3__model_1

3qy2__assembly_3__model_1 | I(q)

3qy2__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)