SAXSdb — 3r08

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

T-cell surface glycoprotein CD3 epsilon chain

Cricetulus migratorius

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Mouse anti-mouse CD3epsilon antibody 2C11 light chain × 1 Mouse anti-mouse CD3epsilon antibody 2C11 heavy chain × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CD3E_MOUSE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain E； PDBConstruct 1–79； UniProt 22–100

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3r08
Deposition date deposition_date	2011-03-07
Structure title title	Crystal structure of mouse cd3epsilon in complex with antibody 2C11 Fab
Keywords keywords	CD3epsilon, antibody, T-cell receptor, signalling, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3r08__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3r08__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3r08__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	29.05 Å
Rg (electron density)	28.81 Å
Total Rg	29.33 Å
Atom count	3944
Residues	511
Excluded volume	69734 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3r08__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Mouse anti-mouse CD3epsilon antibody 2C11 light chain
Molecular weight formula_weight	23646.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L
Atom count atom_count	3944

DIQMTQSPSSLPASLGDRVTINCQASQDISNYLNWYQQKPGKAPKLLIYYTNKLADGVPSRFSGSGSGRDSSFTISSLESEDIGSYYCQQYYNYPWTFGPGTKLEIKRADAKPTVSIFPPSSEQLGTGSATLVCFVNNFYPKDINVKWKVDGSEKRDGVLQSVTDQDSKDSTYSLSSTLSLTKADYERHNLYTCEVTHKTSTAAIVKTLNRNE

Source Source

Source organism organism	Cricetulus migratorius
NCBI taxonomy ID ncbi_taxonomy_id	10032

Entity 2 Entity 2 polymer

Description description	Mouse anti-mouse CD3epsilon antibody 2C11 heavy chain
Molecular weight formula_weight	23149.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

EVQLVESGGGLVQPGKSLKLSCEASGFTFSGYGMHWVRQAPGRGLESVAYITSSSINIKYADAVKGRFTVSRDNAKNLLFLQMNILKSEDTAMYYCARFDWDKNYWGQGTMVTVSSAKTTAPSVYPLAPACDSTTSTTNTVTLGCLVKGYFPEPVTVIWNSGALTSGVHTFPSVLHSGLYSLSSSVTVPSSTWPSQTVTCNVAHPASSTTVDLKIE

Source Source

Source organism organism	Cricetulus migratorius
NCBI taxonomy ID ncbi_taxonomy_id	10032

Entity 3 Entity 3 polymer

Description description	T-cell surface glycoprotein CD3 epsilon chain
Molecular weight formula_weight	9463.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

DDAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVSEY

Source Source

Source organism organism	Cricetulus migratorius
Common name common_name	mouse
NCBI taxonomy ID ncbi_taxonomy_id	10032
Host organism host_organism	Cricetulus griseus

▶

Unit-cell length a length_a	263.177 Å
Unit-cell length b length_b	263.177 Å
Unit-cell length c length_c	263.177 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	48

Space group space_group	I 41 3 2
Space-group number int_tables_number	214
Crystal system crystal_system	—

Resolution resolution	4.100 Å
Low-resolution limit resolution_low	33.150 Å
R factor r_factor	0.2240
R_work r_work	0.2220
R_free r_free	0.2770

Crystal structure of mouse cd3epsilon in complex with antibody 2C11 Fab

1. Protein Identity and Related Structures Protein Identity & Related Structures

T-cell surface glycoprotein CD3 epsilon chain

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3r08__assembly_1__model_1

3r08__assembly_1__model_1 | I(q)

3r08__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (1)

Crystal structure of mouse cd3epsilon in complex with antibody 2C11 Fab

1. Protein Identity and Related Structures Protein Identity & Related Structures

T-cell surface glycoprotein CD3 epsilon chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3r08__assembly_1__model_1

3r08__assembly_1__model_1 | I(q)

3r08__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (1)