SAXSdb — 3rbq

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein unc-119 homolog A

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Guanine nucleotide-binding protein G(t) subunit alpha-1 × 1 （P11488） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Guanine nucleotide-binding protein G(t) subunit alpha-1 × 1 （P11488） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Guanine nucleotide-binding protein G(t) subunit alpha-1 × 1 （P11488） water × 1	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Guanine nucleotide-binding protein G(t) subunit alpha-1 × 1 （P11488） water × 1	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 2	Guanine nucleotide-binding protein G(t) subunit alpha-1 × 1 （P11488） water × 1	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 2	Guanine nucleotide-binding protein G(t) subunit alpha-1 × 1 （P11488） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	U119A_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 11–195； UniProt 56–240 Author chain B； PDBConstruct 11–195； UniProt 56–240 Author chain C； PDBConstruct 11–195； UniProt 56–240 Author chain D； PDBConstruct 11–195； UniProt 56–240 Author chain E； PDBConstruct 11–195； UniProt 56–240 Author chain F； PDBConstruct 11–195； UniProt 56–240

Guanine nucleotide-binding protein G(t) subunit alpha-1

OrganismNot specified

UniProt P11488

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Protein unc-119 homolog A × 1 （Q13432） water × 2	Consistent with protein count
10	Protein monomer	Monomer	Protein 1	No other associated polymer	Consistent with protein count
11	Protein monomer	Monomer	Protein 1	No other associated polymer	Consistent with protein count
12	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Protein unc-119 homolog A × 1 （Q13432） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Protein unc-119 homolog A × 1 （Q13432） water × 1	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Protein unc-119 homolog A × 1 （Q13432） water × 1	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 2	Protein unc-119 homolog A × 1 （Q13432） water × 1	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 2	Protein unc-119 homolog A × 1 （Q13432） water × 2	Consistent with protein count
7	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count
8	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count
9	Protein monomer	Monomer	Protein 1	No other associated polymer	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GNAT1_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain G； PDBConstruct 2–11； UniProt 2–11 Author chain H； PDBConstruct 2–11； UniProt 2–11 Author chain I； PDBConstruct 2–11； UniProt 2–11 Author chain J； PDBConstruct 2–11； UniProt 2–11 Author chain K； PDBConstruct 2–11； UniProt 2–11 Author chain L； PDBConstruct 2–11； UniProt 2–11

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3rbq
Deposition date deposition_date	2011-03-29
Structure title title	Co-crystal structure of human UNC119 (retina gene 4) and an N-terminal Transducin-alpha mimicking peptide
Keywords keywords	;UNC(uncoordinated)119 homolog C. elegans, G protein trafficking, acyl binnding protein, light-induced translocation, UNC119 deletion, Protein Transport-Lipid Binding Protein complex ;; Protein Transport/Lipid Binding Protein
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3rbq__assembly_10__model_1

Assembly 10 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3rbq__assembly_10__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3rbq__assembly_10__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	6.53 Å
Rg (electron density)	6.12 Å
Total Rg	8.29 Å
Atom count	31
Residues	4
Excluded volume	617 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3rbq__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3rbq__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`3rbq__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`3rbq__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`3rbq__assembly_5__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`3rbq__assembly_6__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
7	1	`3rbq__assembly_7__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
8	1	`3rbq__assembly_8__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
9	1	`3rbq__assembly_9__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
10	1	`3rbq__assembly_10__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
11	1	`3rbq__assembly_11__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
12	1	`3rbq__assembly_12__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Protein unc-119 homolog A
Molecular weight formula_weight	23059.1 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F
Atom count atom_count	9360

MGHHHHHHSHRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Guanine nucleotide-binding protein G(t) subunit alpha-1
Molecular weight formula_weight	1140.3 kDa
Source method src_method	syn
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H,I,J,K,L

XGAGASAEEKH

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	793

▼

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

Domain ID domain_id	3rbqA00
Class class	2 — Mainly Beta
Architecture architecture	70 — Distorted Sandwich
Topology topology	50 — Coagulation Factor XIII; Chain A, domain 1
Homologous superfamily homologous superfamily	40 — GMP phosphodiesterase, delta subunit

Domain ID domain_id	3rbqB00
Class class	2 — Mainly Beta
Architecture architecture	70 — Distorted Sandwich
Topology topology	50 — Coagulation Factor XIII; Chain A, domain 1
Homologous superfamily homologous superfamily	40 — GMP phosphodiesterase, delta subunit

Domain ID domain_id	3rbqC00
Class class	2 — Mainly Beta
Architecture architecture	70 — Distorted Sandwich
Topology topology	50 — Coagulation Factor XIII; Chain A, domain 1
Homologous superfamily homologous superfamily	40 — GMP phosphodiesterase, delta subunit

Domain ID domain_id	3rbqD00
Class class	2 — Mainly Beta
Architecture architecture	70 — Distorted Sandwich
Topology topology	50 — Coagulation Factor XIII; Chain A, domain 1
Homologous superfamily homologous superfamily	40 — GMP phosphodiesterase, delta subunit

Domain ID domain_id	3rbqE00
Class class	2 — Mainly Beta
Architecture architecture	70 — Distorted Sandwich
Topology topology	50 — Coagulation Factor XIII; Chain A, domain 1
Homologous superfamily homologous superfamily	40 — GMP phosphodiesterase, delta subunit

Domain ID domain_id	3rbqF00
Class class	2 — Mainly Beta
Architecture architecture	70 — Distorted Sandwich
Topology topology	50 — Coagulation Factor XIII; Chain A, domain 1
Homologous superfamily homologous superfamily	40 — GMP phosphodiesterase, delta subunit

▶

Unit-cell length a length_a	78.546 Å
Unit-cell length b length_b	79.713 Å
Unit-cell length c length_c	189.590 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.000 Å
Low-resolution limit resolution_low	29.370 Å
R factor r_factor	0.1913
R_work r_work	0.1885
R_free r_free	0.2456

Co-crystal structure of human UNC119 (retina gene 4) and an N-terminal Transducin-alpha mimicking peptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein unc-119 homolog A

State in the Current Structure

Other States of the Same Protein in the Database

Guanine nucleotide-binding protein G(t) subunit alpha-1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3rbq__assembly_10__model_1

3rbq__assembly_10__model_1 | I(q)

3rbq__assembly_10__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

7. Citations (1)

Co-crystal structure of human UNC119 (retina gene 4) and an N-terminal Transducin-alpha mimicking peptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein unc-119 homolog A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Guanine nucleotide-binding protein G(t) subunit alpha-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3rbq__assembly_10__model_1

3rbq__assembly_10__model_1 | I(q)

3rbq__assembly_10__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

7. Citations (1)