3s3x

Structure of chicken acid-sensing ion channel 1 AT 3.0 A resolution in complex with psalmotoxin

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Amiloride-sensitive cation channel 2, neuronal

Gallus gallus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Psalmotoxin-1 × 3 （P60514） 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 POTASSIUM ION × 2 CHLORIDE ION × 1 SULFATE ION × 1 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACCN2_CHICK
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 22–459； UniProt 26–463 Author chain B； PDBConstruct 22–459； UniProt 26–463 Author chain C； PDBConstruct 22–459； UniProt 26–463

Psalmotoxin-1

OrganismNot specified

UniProt P60514

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Amiloride-sensitive cation channel 2, neuronal × 3 （Q1XA76） 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 POTASSIUM ION × 2 CHLORIDE ION × 1 SULFATE ION × 1 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TXP1_PSACA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–37； UniProt 2–38 Author chain E； PDBConstruct 1–37； UniProt 2–38 Author chain F； PDBConstruct 1–37； UniProt 2–38

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3s3x
Deposition date deposition_date	2011-05-18
Structure title title	Structure of chicken acid-sensing ion channel 1 AT 3.0 A resolution in complex with psalmotoxin
Keywords keywords	;ACID-SENSING, ION CHANNEL, MEMBRANE PROTEIN, SODIUM CHANNEL, CELL MEMBRANE, GLYCOPROTEIN, ION TRANSPORT, MEMBRANE, SODIUM TRANSPORT, TRANSMEMBRANE, TRANSPORT, TRANSPORT PROTEIN, TOXIN, CYSTEINE KNOT ;; MEMBRANE PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3s3x__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3s3x__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3s3x__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	35.04 Å
Rg (electron density)	34.66 Å
Total Rg	35.28 Å
Atom count	10505
Residues	1299
Excluded volume	187370 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3s3x__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Amiloride-sensitive cation channel 2, neuronal
Molecular weight formula_weight	52622.8 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	10519

MSYYHHHHHHGASLVPRGSHMSTLHGISHIFSYERLSLKRVVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHR

Source Source

Source organism organism	Gallus gallus
Common name common_name	bantam,chickens
NCBI taxonomy ID ncbi_taxonomy_id	9031
Host organism host_organism	Spodoptera frugiperda

Entity 2 Entity 2 polymer

Description description	Psalmotoxin-1
Molecular weight formula_weight	4346.1 kDa
Source method src_method	syn
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F

DCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTP

Entity 3 Entity 3 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	man
Copy count entity_count	6

Entity 4 Entity 4 non-polymer

Description description	POTASSIUM ION
Molecular weight formula_weight	39.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 5 Entity 5 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 7 Entity 7 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	14

▼

6. Fold Classification (SCOP + CATH) 12 domains

CATH v4.4 (12 domains)

Domain ID domain_id	3s3xA01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	770 — YojJ-like

Domain ID domain_id	3s3xA02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	470 — Acid-sensing ion channels like fold
Homologous superfamily homologous superfamily	10 — Acid-sensing ion channels like domains

Domain ID domain_id	3s3xA03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3590 — acid-sensing ion channel 1 fold
Homologous superfamily homologous superfamily	10 — acid-sensing ion channel 1 domain

Domain ID domain_id	3s3xA04
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	820 — Acid-sensing ion channel domain

Domain ID domain_id	3s3xB01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	770 — YojJ-like

Domain ID domain_id	3s3xB02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	470 — Acid-sensing ion channels like fold
Homologous superfamily homologous superfamily	10 — Acid-sensing ion channels like domains

Domain ID domain_id	3s3xB03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3590 — acid-sensing ion channel 1 fold
Homologous superfamily homologous superfamily	10 — acid-sensing ion channel 1 domain

Domain ID domain_id	3s3xB04
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	820 — Acid-sensing ion channel domain

Domain ID domain_id	3s3xC01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	770 — YojJ-like

Domain ID domain_id	3s3xC02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	470 — Acid-sensing ion channels like fold
Homologous superfamily homologous superfamily	10 — Acid-sensing ion channels like domains

Domain ID domain_id	3s3xC03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3590 — acid-sensing ion channel 1 fold
Homologous superfamily homologous superfamily	10 — acid-sensing ion channel 1 domain

Domain ID domain_id	3s3xC04
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	820 — Acid-sensing ion channel domain

▶

Unit-cell length a length_a	232.396 Å
Unit-cell length b length_b	109.442 Å
Unit-cell length c length_c	127.269 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	119.81 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	2.990 Å
Low-resolution limit resolution_low	29.915 Å
R factor r_factor	0.2192
R_work r_work	0.2176
R_free r_free	0.2486

Structure of chicken acid-sensing ion channel 1 AT 3.0 A resolution in complex with psalmotoxin

1. Protein Identity and Related Structures Protein Identity & Related Structures

Amiloride-sensitive cation channel 2, neuronal

State in the Current Structure

Other States of the Same Protein in the Database

Psalmotoxin-1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3s3x__assembly_1__model_1

3s3x__assembly_1__model_1 | I(q)

3s3x__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 12 domains

CATH v4.4 (12 domains)

7. Citations (1)

Structure of chicken acid-sensing ion channel 1 AT 3.0 A resolution in complex with psalmotoxin

1. Protein Identity and Related Structures Protein Identity & Related Structures

Amiloride-sensitive cation channel 2, neuronal

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Psalmotoxin-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3s3x__assembly_1__model_1

3s3x__assembly_1__model_1 | I(q)

3s3x__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 12 domains

CATH v4.4 (12 domains)

7. Citations (1)