SAXSdb — 3sj5

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Methyl-accepting chemotaxis protein

Caldanaerobacter subterraneus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	PROTOPORPHYRIN IX CONTAINING FE × 1 water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	PROTOPORPHYRIN IX CONTAINING FE × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8RBX6_THETN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–188； UniProt 1–188 Author chain B； PDBConstruct 1–188； UniProt 1–188

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3sj5
Deposition date deposition_date	2011-06-20
Structure title title	I5F Mutant Structure of T. Tengcongensis H-NOX
Keywords keywords	NO or O2-sensing protein, SIGNALING PROTEIN; SIGNALING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3sj5__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3sj5__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3sj5__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	17.99 Å
Rg (electron density)	16.80 Å
Total Rg	17.92 Å
Atom count	1549
Residues	183
Excluded volume	27901 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3sj5__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3sj5__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Methyl-accepting chemotaxis protein
Molecular weight formula_weight	22081.5 kDa
Mutation mutation	I5F
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	3483

MKGTFVGTWIKTLRDLYGNDVVDESLKSVGWEPDRVITPLEDIDDDEVRRIFAKVSEKTGKNVNEIWREVGRQNIKTFSEWFPSYFAGRRLVNFLMMMDEVHLQLTKMIKGATPPRLIAKPVAKDAIEMEYVSKRKMYDYFLGLIEGSSKFFKEEISVEEVERGEKDGFSRLKVRIKFKNPVFEYKKN

Source Source

Source organism organism	Caldanaerobacter subterraneus
NCBI taxonomy ID ncbi_taxonomy_id	119072
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	264

▼

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d3sj5a_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.278 — Ligand-binding domain in the NO signalling and Golgi transport
Superfamily Superfamily superfamily	d.278.1 — Ligand-binding domain in the NO signalling and Golgi transport
Family Family family	d.278.1.1 — H-NOX domain

Domain ID domain_id	d3sj5b_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.278 — Ligand-binding domain in the NO signalling and Golgi transport
Superfamily Superfamily superfamily	d.278.1 — Ligand-binding domain in the NO signalling and Golgi transport
Family Family family	d.278.1.1 — H-NOX domain

CATH v4.4 (2 domains)

Domain ID domain_id	3sj5A00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1520 — H-NOX domain
Homologous superfamily homologous superfamily	10 — H-NOX domain

Domain ID domain_id	3sj5B00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1520 — H-NOX domain
Homologous superfamily homologous superfamily	10 — H-NOX domain

▶

Unit-cell length a length_a	44.585 Å
Unit-cell length b length_b	67.116 Å
Unit-cell length c length_c	66.428 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	92.01 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.673 Å
Low-resolution limit resolution_low	47.198 Å
R factor r_factor	0.1999
R_work r_work	0.1974
R_free r_free	0.2471

I5F Mutant Structure of T. Tengcongensis H-NOX

1. Protein Identity and Related Structures Protein Identity & Related Structures

Methyl-accepting chemotaxis protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3sj5__assembly_2__model_1

3sj5__assembly_2__model_1 | I(q)

3sj5__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)

I5F Mutant Structure of T. Tengcongensis H-NOX

1. Protein Identity and Related Structures Protein Identity & Related Structures

Methyl-accepting chemotaxis protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3sj5__assembly_2__model_1

3sj5__assembly_2__model_1 | I(q)

3sj5__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)