SAXSdb — 3syn

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar biosynthesis protein flhF

Bacillus subtilis

UniProt Q01960

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	ATP-binding protein YlxH × 1 （P40742） GUANOSINE-5'-DIPHOSPHATE × 1 MAGNESIUM ION × 1 ALUMINUM FLUORIDE × 1 SULFATE ION × 5 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	ATP-binding protein YlxH × 1 （P40742） GUANOSINE-5'-DIPHOSPHATE × 1 MAGNESIUM ION × 1 ALUMINUM FLUORIDE × 1 SULFATE ION × 3 water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	ATP-binding protein YlxH × 1 （P40742） GUANOSINE-5'-DIPHOSPHATE × 1 MAGNESIUM ION × 1 ALUMINUM FLUORIDE × 1 SULFATE ION × 4 water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	ATP-binding protein YlxH × 1 （P40742） GUANOSINE-5'-DIPHOSPHATE × 1 MAGNESIUM ION × 1 ALUMINUM FLUORIDE × 1 SULFATE ION × 3 water × 1	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 8	ATP-binding protein YlxH × 4 （P40742） GUANOSINE-5'-DIPHOSPHATE × 4 MAGNESIUM ION × 4 ALUMINUM FLUORIDE × 4 SULFATE ION × 15 water × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLHF_BACSU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 9–296； UniProt 79–366 Author chain B； PDBConstruct 9–296； UniProt 79–366 Author chain C； PDBConstruct 9–296； UniProt 79–366 Author chain D； PDBConstruct 9–296； UniProt 79–366

ATP-binding protein YlxH

OrganismNot specified

UniProt P40742

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Flagellar biosynthesis protein flhF × 1 （Q01960） GUANOSINE-5'-DIPHOSPHATE × 1 MAGNESIUM ION × 1 ALUMINUM FLUORIDE × 1 SULFATE ION × 5 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Flagellar biosynthesis protein flhF × 1 （Q01960） GUANOSINE-5'-DIPHOSPHATE × 1 MAGNESIUM ION × 1 ALUMINUM FLUORIDE × 1 SULFATE ION × 3 water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Flagellar biosynthesis protein flhF × 1 （Q01960） GUANOSINE-5'-DIPHOSPHATE × 1 MAGNESIUM ION × 1 ALUMINUM FLUORIDE × 1 SULFATE ION × 4 water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Flagellar biosynthesis protein flhF × 1 （Q01960） GUANOSINE-5'-DIPHOSPHATE × 1 MAGNESIUM ION × 1 ALUMINUM FLUORIDE × 1 SULFATE ION × 3 water × 1	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 8	Flagellar biosynthesis protein flhF × 4 （Q01960） GUANOSINE-5'-DIPHOSPHATE × 4 MAGNESIUM ION × 4 ALUMINUM FLUORIDE × 4 SULFATE ION × 15 water × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	YLXH_BACSU
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 1–23； UniProt 1–23 Author chain F； PDBConstruct 1–23； UniProt 1–23 Author chain G； PDBConstruct 1–23； UniProt 1–23 Author chain H； PDBConstruct 1–23； UniProt 1–23

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3syn
Deposition date deposition_date	2011-07-18
Structure title title	Crystal structure of FlhF in complex with its activator
Keywords keywords	;SRP GTPASE, FLAGELLUM, PROTEIN TRANSPORT, BIOSYNTHETIC PROTEIN, GTPase ACTIVATING PROTEIN, Type 3 secretion system, GTP-binding protein ;; PROTEIN TRANSPORT
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3syn__assembly_5__model_1

Assembly 5 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3syn__assembly_5__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3syn__assembly_5__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	44.24 Å
Rg (electron density)	44.43 Å
Total Rg	44.36 Å
Atom count	8919
Residues	1096
Excluded volume	159650 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3syn__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3syn__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`3syn__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`3syn__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`3syn__assembly_5__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Flagellar biosynthesis protein flhF
Molecular weight formula_weight	33432.2 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	9010

MGHHHHHHSSPKIEERTYPPQIPAQQELGDFSAYQSVLPEPLRKAEKLLQETGIKESTKTNTLKKLLRFSVEAGGLTEENVVGKLQEILCDMLPSADKWQEPIHSKYIVLFGSTGAGKTTTLAKLAAISMLEKHKKIAFITTDTYRIAAVEQLKTYAELLQAPLEVCYTKEEFQQAKELFSEYDHVFVDTAGRNFKDPQYIDELKETIPFESSIQSFLVLSATAKYEDMKHIVKRFSSVPVNQYIFTKIDETTSLGSVFNILAESKIGVGFMTNGQNVPEDIQTVSPLGFVRMLCR

Source Source

Source organism organism	Bacillus subtilis
NCBI taxonomy ID ncbi_taxonomy_id	1423
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	ATP-binding protein YlxH
Molecular weight formula_weight	2845.4 kDa
Source method src_method	syn
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,G,H

MQMNRYDQAATLRAKMEKRERVL

Entity 3 Entity 3 non-polymer

Description description	GUANOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	443.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 4 Entity 4 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 5 Entity 5 non-polymer

Description description	ALUMINUM FLUORIDE
Molecular weight formula_weight	84.0 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 6 Entity 6 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	15

Entity 7 Entity 7 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	91

▼

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

Domain ID domain_id	3synA01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	1380 — Flagellar FlhF biosynthesis protein, N domain

Domain ID domain_id	3synA02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	3synB01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	1380 — Flagellar FlhF biosynthesis protein, N domain

Domain ID domain_id	3synB02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	3synC01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	1380 — Flagellar FlhF biosynthesis protein, N domain

Domain ID domain_id	3synC02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	3synD01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	1380 — Flagellar FlhF biosynthesis protein, N domain

Domain ID domain_id	3synD02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

▶

Unit-cell length a length_a	50.790 Å
Unit-cell length b length_b	63.360 Å
Unit-cell length c length_c	114.500 Å
Unit-cell angle α angle_alpha	92.26 °
Unit-cell angle β angle_beta	100.96 °
Unit-cell angle γ angle_gamma	94.25 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.063 Å
Low-resolution limit resolution_low	63.091 Å
R factor r_factor	0.1838
R_work r_work	0.1809
R_free r_free	0.2388

Crystal structure of FlhF in complex with its activator

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar biosynthesis protein flhF

State in the Current Structure

Other States of the Same Protein in the Database

ATP-binding protein YlxH

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3syn__assembly_5__model_1

3syn__assembly_5__model_1 | I(q)

3syn__assembly_5__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

7. Citations (1)

Crystal structure of FlhF in complex with its activator

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar biosynthesis protein flhF

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP-binding protein YlxH

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3syn__assembly_5__model_1

3syn__assembly_5__model_1 | I(q)

3syn__assembly_5__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

7. Citations (1)