SAXSdb — 3vjf

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

No usable UniProt protein identity is available for this entry.

The relationship tables retain this entry's assembly and composition data, but cross-PDB links for the same protein cannot be established reliably without a unified protein identity.

Assembly Composition of the Current Entry

Assembly	Physical composition	Protein state	蛋白 / DNA / RNA / 其他Polymer	Data consistency
1	Protein homooligomer	Homooligomer	2 / 0 / 0 / 0	Consistent with protein count

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3vjf
Deposition date deposition_date	2011-10-18
Structure title title	Crystal structure of de novo 4-helix bundle protein WA20
Keywords keywords	PROTEIN DESIGN, DE NOVO PROTEIN, BINARY PATTERNED DESIGN, FOUR HELIX BUNDLE, 3D DOMAIN SWAPPING, Rudimentary enzymatic activities; DE NOVO PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3vjf__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3vjf__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3vjf__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	22.15 Å
Rg (electron density)	22.31 Å
Total Rg	23.06 Å
Atom count	1636
Residues	175
Excluded volume	28611 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3vjf__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	WA20
Molecular weight formula_weight	12943.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	1691

MYGKLNKLVEHIKELLQQLNKNWHRHQGNLHDMNQQMEQLFQEFQHFMQGNQDDGKLQNMIHEMQQFMNQVDNHLQSESDTVHHFHNKLQELMNNFHHLVHR

Source Source

Source organism organism	synthetic construct
NCBI taxonomy ID ncbi_taxonomy_id	32630
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	POTASSIUM ION
Molecular weight formula_weight	39.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	55

▼

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	3vjfA00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1480 — hypothetical protein mp506/mpn330, domain 1
Homologous superfamily homologous superfamily	30 — Designed four-helix bundle protein

Domain ID domain_id	3vjfB00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1480 — hypothetical protein mp506/mpn330, domain 1
Homologous superfamily homologous superfamily	30 — Designed four-helix bundle protein

▶

Unit-cell length a length_a	65.950 Å
Unit-cell length b length_b	102.858 Å
Unit-cell length c length_c	31.344 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	2.200 Å
Low-resolution limit resolution_low	50.000 Å
R factor r_factor	0.2340
R_work r_work	0.2330
R_free r_free	0.2550

Crystal structure of de novo 4-helix bundle protein WA20