4eeo

Crystal structure of human M340H-beta-1,4-galactosyltransferase-1 (M340H-B4GAL-T1) in complex with GLCNAC-BETA1,6-GlcNAc-ALPHA-benzyl

Method: X-RAY DIFFRACTION D_max: 99.0 Å Quality: REASONABLE

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Beta-1,4-galactosyltransferase 1

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Monomer Protein × 1 其他Polymer 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain A； UniProt 126–398	Fragment：catalytic domain Mutation：R337T, C338T, M340H	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-6)-benzyl 2-acetamido-2-deoxy-alpha-D-glucopyranoside × 1 UDP URIDINE-5'-DIPHOSPHATE × 1 MN MANGANESE (II) ION × 1 SO4 SULFATE ION × 4 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM mes buffer, 1.6 M ammonium sulfate, 2% dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.30 Å R-free 0.255
2	Other combination Monomer Protein × 1 其他Polymer 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain B； UniProt 126–398	Fragment：catalytic domain Mutation：R337T, C338T, M340H	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-6)-benzyl 2-acetamido-2-deoxy-alpha-D-glucopyranoside × 1 UDP URIDINE-5'-DIPHOSPHATE × 1 MN MANGANESE (II) ION × 1 SO4 SULFATE ION × 5 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM mes buffer, 1.6 M ammonium sulfate, 2% dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.30 Å R-free 0.255
3	Other combination Monomer Protein × 1 其他Polymer 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain C； UniProt 126–398	Fragment：catalytic domain Mutation：R337T, C338T, M340H	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-6)-benzyl 2-acetamido-2-deoxy-alpha-D-glucopyranoside × 1 UDP URIDINE-5'-DIPHOSPHATE × 1 MN MANGANESE (II) ION × 1 SO4 SULFATE ION × 2 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM mes buffer, 1.6 M ammonium sulfate, 2% dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.30 Å R-free 0.255
4	Other combination Homooligomer Protein × 3 其他Polymer 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain A； UniProt 126–398 Chain B； UniProt 126–398 Chain C； UniProt 126–398	Fragment：catalytic domain Mutation：R337T, C338T, M340H	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-6)-benzyl 2-acetamido-2-deoxy-alpha-D-glucopyranoside × 3 UDP URIDINE-5'-DIPHOSPHATE × 3 MN MANGANESE (II) ION × 3 SO4 SULFATE ION × 11 GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM mes buffer, 1.6 M ammonium sulfate, 2% dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.30 Å R-free 0.255

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4EEO	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2AE7 Crystal Structure of Human M340H-Beta1,4-Galactosyltransferase-I (M340H-B4GAL-T1) in Complex with Pentasaccharide Deposited 2005-07-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 125–397（273 aa） Fragment：Catalytic domain, Residues 126-398	Mutation：M340H, C338T, R337T	MN MANGANESE (II) ION × 1 SO4 SULFATE ION × 4 UDH 6-AMINOHEXYL-URIDINE-C1,5'-DIPHOSPHATE × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；mes, ammonium sulfate, dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.246
2AE7 Crystal Structure of Human M340H-Beta1,4-Galactosyltransferase-I (M340H-B4GAL-T1) in Complex with Pentasaccharide Deposited 2005-07-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain B 125–397（273 aa） Fragment：Catalytic domain, Residues 126-398	Mutation：M340H, C338T, R337T	MN MANGANESE (II) ION × 1 SO4 SULFATE ION × 6 UDH 6-AMINOHEXYL-URIDINE-C1,5'-DIPHOSPHATE × 1 GOL GLYCEROL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；mes, ammonium sulfate, dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.246
2AE7 Crystal Structure of Human M340H-Beta1,4-Galactosyltransferase-I (M340H-B4GAL-T1) in Complex with Pentasaccharide Deposited 2005-07-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain C 125–397（273 aa） Fragment：Catalytic domain, Residues 126-398	Mutation：M340H, C338T, R337T	MN MANGANESE (II) ION × 1 SO4 SULFATE ION × 4 UDH 6-AMINOHEXYL-URIDINE-C1,5'-DIPHOSPHATE × 1 GOL GLYCEROL × 1 DIO 1,4-DIETHYLENE DIOXIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；mes, ammonium sulfate, dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.246
2AE7 Crystal Structure of Human M340H-Beta1,4-Galactosyltransferase-I (M340H-B4GAL-T1) in Complex with Pentasaccharide Deposited 2005-07-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 125–397（273 aa） Fragment：Catalytic domain, Residues 126-398 Chain B 125–397（273 aa） Fragment：Catalytic domain, Residues 126-398 Chain C 125–397（273 aa） Fragment：Catalytic domain, Residues 126-398	Mutation：M340H, C338T, R337T Mutation：M340H, C338T, R337T Mutation：M340H, C338T, R337T	MN MANGANESE (II) ION × 3 SO4 SULFATE ION × 14 UDH 6-AMINOHEXYL-URIDINE-C1,5'-DIPHOSPHATE × 3 GOL GLYCEROL × 7 DIO 1,4-DIETHYLENE DIOXIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；mes, ammonium sulfate, dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.246
2AEC Crystal Structure of Human M340H-Beta1,4-Galactosyltransferase-I (M340H-B4GAL-T1) in Complex with GlcNAc-beta1,2-Man-alpha1,6-Man-beta-OR Deposited 2005-07-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 125–397（273 aa） Fragment：Catalytic domain, Residues 126-398	Mutation：M340H, C338T, R337T	MN MANGANESE (II) ION × 1 SO4 SULFATE ION × 4 UDH 6-AMINOHEXYL-URIDINE-C1,5'-DIPHOSPHATE × 1 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；mes, ammonium sulfate, dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.239
2AEC Crystal Structure of Human M340H-Beta1,4-Galactosyltransferase-I (M340H-B4GAL-T1) in Complex with GlcNAc-beta1,2-Man-alpha1,6-Man-beta-OR Deposited 2005-07-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain B 125–397（273 aa） Fragment：Catalytic domain, Residues 126-398	Mutation：M340H, C338T, R337T	MN MANGANESE (II) ION × 1 SO4 SULFATE ION × 6 UDH 6-AMINOHEXYL-URIDINE-C1,5'-DIPHOSPHATE × 1 GOL GLYCEROL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；mes, ammonium sulfate, dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.239
2AEC Crystal Structure of Human M340H-Beta1,4-Galactosyltransferase-I (M340H-B4GAL-T1) in Complex with GlcNAc-beta1,2-Man-alpha1,6-Man-beta-OR Deposited 2005-07-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain C 125–397（273 aa） Fragment：Catalytic domain, Residues 126-398	Mutation：M340H, C338T, R337T	MN MANGANESE (II) ION × 1 SO4 SULFATE ION × 4 UDH 6-AMINOHEXYL-URIDINE-C1,5'-DIPHOSPHATE × 1 GOL GLYCEROL × 1 DIO 1,4-DIETHYLENE DIOXIDE × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；mes, ammonium sulfate, dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.239
2AES Crystal Structure of Human M340H-Beta1,4-Galactosyltransferase-I (M340H-B4Gal-T1) in Complex with GlcNAc-beta1,2-Man-alpha1,3-Man-beta-OR Deposited 2005-07-23	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 125–397（273 aa） Fragment：Catalytic domain, Residues 126-398	Mutation：M340H, C338T, R337T	MN MANGANESE (II) ION × 1 SO4 SULFATE ION × 4 UDH 6-AMINOHEXYL-URIDINE-C1,5'-DIPHOSPHATE × 1 GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；mes, ammonium sulfate, dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.232
2AES Crystal Structure of Human M340H-Beta1,4-Galactosyltransferase-I (M340H-B4Gal-T1) in Complex with GlcNAc-beta1,2-Man-alpha1,3-Man-beta-OR Deposited 2005-07-23	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain B 125–397（273 aa） Fragment：Catalytic domain, Residues 126-398	Mutation：M340H, C338T, R337T	MN MANGANESE (II) ION × 1 SO4 SULFATE ION × 6 UDH 6-AMINOHEXYL-URIDINE-C1,5'-DIPHOSPHATE × 1 GOL GLYCEROL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；mes, ammonium sulfate, dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.232
2AES Crystal Structure of Human M340H-Beta1,4-Galactosyltransferase-I (M340H-B4Gal-T1) in Complex with GlcNAc-beta1,2-Man-alpha1,3-Man-beta-OR Deposited 2005-07-23	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain C 125–397（273 aa） Fragment：Catalytic domain, Residues 126-398	Mutation：M340H, C338T, R337T	MN MANGANESE (II) ION × 1 SO4 SULFATE ION × 3 UDH 6-AMINOHEXYL-URIDINE-C1,5'-DIPHOSPHATE × 1 GOL GLYCEROL × 1 DIO 1,4-DIETHYLENE DIOXIDE × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；mes, ammonium sulfate, dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.232
2AGD Crystal Structure of Human M340H-Beta-1,4-Galactosyltransferase-I(M340H-B4Gal-T1) in Complex with GlcNAc-beta1,4-Man-alpha1,3-Man-beta-OR Deposited 2005-07-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 125–397（273 aa） Fragment：Catalytic domain, Residues 126-398	Mutation：M340H, C338T, R337T	MN MANGANESE (II) ION × 1 SO4 SULFATE ION × 4 UDH 6-AMINOHEXYL-URIDINE-C1,5'-DIPHOSPHATE × 1 GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；mes, ammonium sulfate, dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.90 Å R-free 0.228
2AGD Crystal Structure of Human M340H-Beta-1,4-Galactosyltransferase-I(M340H-B4Gal-T1) in Complex with GlcNAc-beta1,4-Man-alpha1,3-Man-beta-OR Deposited 2005-07-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain B 125–397（273 aa） Fragment：Catalytic domain, Residues 126-398	Mutation：M340H, C338T, R337T	MN MANGANESE (II) ION × 1 SO4 SULFATE ION × 7 UDH 6-AMINOHEXYL-URIDINE-C1,5'-DIPHOSPHATE × 1 GOL GLYCEROL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；mes, ammonium sulfate, dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.90 Å R-free 0.228
2AGD Crystal Structure of Human M340H-Beta-1,4-Galactosyltransferase-I(M340H-B4Gal-T1) in Complex with GlcNAc-beta1,4-Man-alpha1,3-Man-beta-OR Deposited 2005-07-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain C 125–397（273 aa） Fragment：Catalytic domain, Residues 126-398	Mutation：M340H, C338T, R337T	MN MANGANESE (II) ION × 1 SO4 SULFATE ION × 5 UDH 6-AMINOHEXYL-URIDINE-C1,5'-DIPHOSPHATE × 1 GOL GLYCEROL × 1 DIO 1,4-DIETHYLENE DIOXIDE × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；mes, ammonium sulfate, dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.90 Å R-free 0.228
2AH9 Crystal Structure of Human M340H-Beta-1,4-Galactosyltransferase-I (M340H-B4Gal-T1) in Complex with Chitotriose Deposited 2005-07-27	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 125–397（273 aa） Fragment：Catalytic domain, Residues 126-398	Mutation：M340H, C338T, R337T	UDH 6-AMINOHEXYL-URIDINE-C1,5'-DIPHOSPHATE × 1 MN MANGANESE (II) ION × 1 GOL GLYCEROL × 2 SO4 SULFATE ION × 4 DIO 1,4-DIETHYLENE DIOXIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；mes, ammonium sulfate, dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.224
2AH9 Crystal Structure of Human M340H-Beta-1,4-Galactosyltransferase-I (M340H-B4Gal-T1) in Complex with Chitotriose Deposited 2005-07-27	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain B 125–397（273 aa） Fragment：Catalytic domain, Residues 126-398	Mutation：M340H, C338T, R337T	UDH 6-AMINOHEXYL-URIDINE-C1,5'-DIPHOSPHATE × 1 MN MANGANESE (II) ION × 1 GOL GLYCEROL × 4 SO4 SULFATE ION × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；mes, ammonium sulfate, dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.224
2AH9 Crystal Structure of Human M340H-Beta-1,4-Galactosyltransferase-I (M340H-B4Gal-T1) in Complex with Chitotriose Deposited 2005-07-27	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain C 125–397（273 aa） Fragment：Catalytic domain, Residues 126-398	Mutation：M340H, C338T, R337T	UDH 6-AMINOHEXYL-URIDINE-C1,5'-DIPHOSPHATE × 1 MN MANGANESE (II) ION × 1 GOL GLYCEROL × 1 SO4 SULFATE ION × 5 DIO 1,4-DIETHYLENE DIOXIDE × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；mes, ammonium sulfate, dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.224
2AH9 Crystal Structure of Human M340H-Beta-1,4-Galactosyltransferase-I (M340H-B4Gal-T1) in Complex with Chitotriose Deposited 2005-07-27	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 125–397（273 aa） Fragment：Catalytic domain, Residues 126-398 Chain B 125–397（273 aa） Fragment：Catalytic domain, Residues 126-398 Chain C 125–397（273 aa） Fragment：Catalytic domain, Residues 126-398	Mutation：M340H, C338T, R337T Mutation：M340H, C338T, R337T Mutation：M340H, C338T, R337T	UDH 6-AMINOHEXYL-URIDINE-C1,5'-DIPHOSPHATE × 3 MN MANGANESE (II) ION × 3 GOL GLYCEROL × 7 SO4 SULFATE ION × 16 DIO 1,4-DIETHYLENE DIOXIDE × 2 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；mes, ammonium sulfate, dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.224
2FY7 Crystal structure of the catalytic domain of the human beta1,4-galactosyltransferase mutant M339H in apo form Deposited 2006-02-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 125–397（273 aa） Fragment：catalytic domain, residues 125-397	Mutation：R337T, C338T, M340H	PGE TRIETHYLENE GLYCOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.6；298 K；50 mM sodium citrate buffer, 6% PEG 4000, pH 5.6, VAPOR DIFFUSION, temperature 298K	Resolution 1.70 Å R-free 0.222
2FYA Crystal structure of the catalytic domain of the human beta1, 4-galactosyltransferase mutant M339H complex with manganese Deposited 2006-02-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 125–397（273 aa） Fragment：catalytic domain, residues 125-397	Mutation：R337T, C338T, M340H	MN MANGANESE (II) ION × 1 PGE TRIETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.6；298 K；10 mg/ml protein solution, 5 mM manganese chloride, 50 mM sodium citrate buffer, 6% PEG 4000, pH 5.6, VAPOR DIFFUSION, temperature 298K	Resolution 1.90 Å R-free 0.226
2FYB Crystal structure of the catalytic domain of the human beta1,4-galactosyltransferase mutant M339H in complex with Mn and UDP-galactose in open conformation Deposited 2006-02-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 125–397（273 aa） Fragment：catalytic domain, residues 125-397	Mutation：R337T, C338T, M340H	MN MANGANESE (II) ION × 1 UDP URIDINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.6；298 K；10 mg/ml protein solution, 5mM manganese chloride, 5mM UDP-galactose, 50 mM sodium citrate, 6% PEG 4000, pH 5.6, VAPOR DIFFUSION, temperature 298K	Resolution 1.90 Å R-free 0.216
3EE5 Crystal structure of human M340H-Beta1,4-Galactosyltransferase-I (M340H-B4GAL-T1) in complex with GLCNAC-Beta1,3-Gal-Beta-Naphthalenemethanol Deposited 2008-09-04	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 126–398（273 aa） Fragment：Catalytic domain of Beta-1,4-Galactosyltransferase	Mutation：d126, M340H, C338T, R337T	UDH 6-AMINOHEXYL-URIDINE-C1,5'-DIPHOSPHATE × 1 2NA naphthalen-2-ylmethanol × 1 SO4 SULFATE ION × 5 MN MANGANESE (II) ION × 1 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 6.5；298 K；MES, AMMONIUM SULFATE, DIOXANE, pH 6.5, EVAPORATION, temperature 298K	Resolution 2.20 Å R-free 0.240
3EE5 Crystal structure of human M340H-Beta1,4-Galactosyltransferase-I (M340H-B4GAL-T1) in complex with GLCNAC-Beta1,3-Gal-Beta-Naphthalenemethanol Deposited 2008-09-04	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain B 126–398（273 aa） Fragment：Catalytic domain of Beta-1,4-Galactosyltransferase	Mutation：d126, M340H, C338T, R337T	UDH 6-AMINOHEXYL-URIDINE-C1,5'-DIPHOSPHATE × 1 2NA naphthalen-2-ylmethanol × 1 SO4 SULFATE ION × 7 MN MANGANESE (II) ION × 1 GOL GLYCEROL × 4	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 6.5；298 K；MES, AMMONIUM SULFATE, DIOXANE, pH 6.5, EVAPORATION, temperature 298K	Resolution 2.20 Å R-free 0.240
3EE5 Crystal structure of human M340H-Beta1,4-Galactosyltransferase-I (M340H-B4GAL-T1) in complex with GLCNAC-Beta1,3-Gal-Beta-Naphthalenemethanol Deposited 2008-09-04	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain C 126–398（273 aa） Fragment：Catalytic domain of Beta-1,4-Galactosyltransferase	Mutation：d126, M340H, C338T, R337T	UDH 6-AMINOHEXYL-URIDINE-C1,5'-DIPHOSPHATE × 1 2NA naphthalen-2-ylmethanol × 1 SO4 SULFATE ION × 2 MN MANGANESE (II) ION × 1 GOL GLYCEROL × 1 DIO 1,4-DIETHYLENE DIOXIDE × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 6.5；298 K；MES, AMMONIUM SULFATE, DIOXANE, pH 6.5, EVAPORATION, temperature 298K	Resolution 2.20 Å R-free 0.240
4EE3 Crystal structure of human M340H-beta-1,4-galactosyltransferase-1 (M340H-B4GAL-T1) in complex with pentasaccharide Deposited 2012-03-28	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 126–398（273 aa） Fragment：Catalytic domain	Mutation：R337T, C338T, M340H	UDH 6-AMINOHEXYL-URIDINE-C1,5'-DIPHOSPHATE × 1 MN MANGANESE (II) ION × 1 SO4 SULFATE ION × 8 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM Mes buffer, 1.6 M ammonium sulfate, 2% Dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.30 Å R-free 0.240
4EE3 Crystal structure of human M340H-beta-1,4-galactosyltransferase-1 (M340H-B4GAL-T1) in complex with pentasaccharide Deposited 2012-03-28	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain B 126–398（273 aa） Fragment：Catalytic domain	Mutation：R337T, C338T, M340H	UDH 6-AMINOHEXYL-URIDINE-C1,5'-DIPHOSPHATE × 1 MN MANGANESE (II) ION × 1 SO4 SULFATE ION × 6 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM Mes buffer, 1.6 M ammonium sulfate, 2% Dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.30 Å R-free 0.240
4EE3 Crystal structure of human M340H-beta-1,4-galactosyltransferase-1 (M340H-B4GAL-T1) in complex with pentasaccharide Deposited 2012-03-28	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain C 126–398（273 aa） Fragment：Catalytic domain	Mutation：R337T, C338T, M340H	UDH 6-AMINOHEXYL-URIDINE-C1,5'-DIPHOSPHATE × 1 MN MANGANESE (II) ION × 1 SO4 SULFATE ION × 4 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM Mes buffer, 1.6 M ammonium sulfate, 2% Dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.30 Å R-free 0.240
4EE3 Crystal structure of human M340H-beta-1,4-galactosyltransferase-1 (M340H-B4GAL-T1) in complex with pentasaccharide Deposited 2012-03-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 126–398（273 aa） Fragment：Catalytic domain Chain B 126–398（273 aa） Fragment：Catalytic domain Chain C 126–398（273 aa） Fragment：Catalytic domain	Mutation：R337T, C338T, M340H Mutation：R337T, C338T, M340H Mutation：R337T, C338T, M340H	UDH 6-AMINOHEXYL-URIDINE-C1,5'-DIPHOSPHATE × 6 MN MANGANESE (II) ION × 6 SO4 SULFATE ION × 36 GOL GLYCEROL × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM Mes buffer, 1.6 M ammonium sulfate, 2% Dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.30 Å R-free 0.240
4EE3 Crystal structure of human M340H-beta-1,4-galactosyltransferase-1 (M340H-B4GAL-T1) in complex with pentasaccharide Deposited 2012-03-28	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Other combination Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 126–398（273 aa） Fragment：Catalytic domain Chain B 126–398（273 aa） Fragment：Catalytic domain Chain C 126–398（273 aa） Fragment：Catalytic domain	Mutation：R337T, C338T, M340H Mutation：R337T, C338T, M340H Mutation：R337T, C338T, M340H	UDH 6-AMINOHEXYL-URIDINE-C1,5'-DIPHOSPHATE × 3 MN MANGANESE (II) ION × 3 SO4 SULFATE ION × 18 GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM Mes buffer, 1.6 M ammonium sulfate, 2% Dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.30 Å R-free 0.240
4EE4 Crystal structure of human M340H-beta-1,4-galactosyltransferase-1 (M340H-B4GAL-T1) in complex with tetrasaccharide from Lacto-N-neohexose Deposited 2012-03-28	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 126–398（273 aa） Fragment：Catalytic domain	Mutation：R337T, C338T, M340H	UDP URIDINE-5'-DIPHOSPHATE × 1 MN MANGANESE (II) ION × 1 SO4 SULFATE ION × 7 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM mes buffer, 1.6 ammonium sulfate, 2% dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.95 Å R-free 0.232
4EE4 Crystal structure of human M340H-beta-1,4-galactosyltransferase-1 (M340H-B4GAL-T1) in complex with tetrasaccharide from Lacto-N-neohexose Deposited 2012-03-28	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain B 126–398（273 aa） Fragment：Catalytic domain	Mutation：R337T, C338T, M340H	UDP URIDINE-5'-DIPHOSPHATE × 1 MN MANGANESE (II) ION × 1 SO4 SULFATE ION × 11 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM mes buffer, 1.6 ammonium sulfate, 2% dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.95 Å R-free 0.232
4EE4 Crystal structure of human M340H-beta-1,4-galactosyltransferase-1 (M340H-B4GAL-T1) in complex with tetrasaccharide from Lacto-N-neohexose Deposited 2012-03-28	Different construct Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain C 126–398（273 aa） Fragment：Catalytic domain	Mutation：R337T, C338T, M340H	UDP URIDINE-5'-DIPHOSPHATE × 1 MN MANGANESE (II) ION × 1 SO4 SULFATE ION × 4 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM mes buffer, 1.6 ammonium sulfate, 2% dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.95 Å R-free 0.232
4EE4 Crystal structure of human M340H-beta-1,4-galactosyltransferase-1 (M340H-B4GAL-T1) in complex with tetrasaccharide from Lacto-N-neohexose Deposited 2012-03-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 126–398（273 aa） Fragment：Catalytic domain Chain B 126–398（273 aa） Fragment：Catalytic domain Chain C 126–398（273 aa） Fragment：Catalytic domain	Mutation：R337T, C338T, M340H Mutation：R337T, C338T, M340H Mutation：R337T, C338T, M340H	UDP URIDINE-5'-DIPHOSPHATE × 6 MN MANGANESE (II) ION × 6 SO4 SULFATE ION × 44 GOL GLYCEROL × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM mes buffer, 1.6 ammonium sulfate, 2% dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.95 Å R-free 0.232
4EE4 Crystal structure of human M340H-beta-1,4-galactosyltransferase-1 (M340H-B4GAL-T1) in complex with tetrasaccharide from Lacto-N-neohexose Deposited 2012-03-28	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Other combination Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 126–398（273 aa） Fragment：Catalytic domain Chain B 126–398（273 aa） Fragment：Catalytic domain Chain C 126–398（273 aa） Fragment：Catalytic domain	Mutation：R337T, C338T, M340H Mutation：R337T, C338T, M340H Mutation：R337T, C338T, M340H	UDP URIDINE-5'-DIPHOSPHATE × 3 MN MANGANESE (II) ION × 3 SO4 SULFATE ION × 22 GOL GLYCEROL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM mes buffer, 1.6 ammonium sulfate, 2% dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.95 Å R-free 0.232
4EE5 Crystal structure of human M340H-beta-1,4-galactosyltransferase-1 (M340H-B4GAL-T1) in complex with trisaccharide from Lacto-N-neotetraose Deposited 2012-03-28	Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 126–398（273 aa） Fragment：catalytic domain	Mutation：R337T, C338T, M340H	UDP URIDINE-5'-DIPHOSPHATE × 1 MN MANGANESE (II) ION × 1 GOL GLYCEROL × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM mes buffer, 1.6 M ammonium sulfate, 2% dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.20 Å R-free 0.250
4EE5 Crystal structure of human M340H-beta-1,4-galactosyltransferase-1 (M340H-B4GAL-T1) in complex with trisaccharide from Lacto-N-neotetraose Deposited 2012-03-28	Different ligand/ion Different structure-quality metrics	Assembly 2 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain B 126–398（273 aa） Fragment：catalytic domain	Mutation：R337T, C338T, M340H	UDP URIDINE-5'-DIPHOSPHATE × 1 MN MANGANESE (II) ION × 1 GOL GLYCEROL × 2 SO4 SULFATE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM mes buffer, 1.6 M ammonium sulfate, 2% dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.20 Å R-free 0.250
4EE5 Crystal structure of human M340H-beta-1,4-galactosyltransferase-1 (M340H-B4GAL-T1) in complex with trisaccharide from Lacto-N-neotetraose Deposited 2012-03-28	Different structure-quality metrics	Assembly 3 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain C 126–398（273 aa） Fragment：catalytic domain	Mutation：R337T, C338T, M340H	UDP URIDINE-5'-DIPHOSPHATE × 1 MN MANGANESE (II) ION × 1 GOL GLYCEROL × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM mes buffer, 1.6 M ammonium sulfate, 2% dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.20 Å R-free 0.250
4EE5 Crystal structure of human M340H-beta-1,4-galactosyltransferase-1 (M340H-B4GAL-T1) in complex with trisaccharide from Lacto-N-neotetraose Deposited 2012-03-28	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 4 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 126–398（273 aa） Fragment：catalytic domain Chain B 126–398（273 aa） Fragment：catalytic domain Chain C 126–398（273 aa） Fragment：catalytic domain	Mutation：R337T, C338T, M340H Mutation：R337T, C338T, M340H Mutation：R337T, C338T, M340H	UDP URIDINE-5'-DIPHOSPHATE × 6 MN MANGANESE (II) ION × 6 GOL GLYCEROL × 8 SO4 SULFATE ION × 22	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM mes buffer, 1.6 M ammonium sulfate, 2% dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.20 Å R-free 0.250
4EE5 Crystal structure of human M340H-beta-1,4-galactosyltransferase-1 (M340H-B4GAL-T1) in complex with trisaccharide from Lacto-N-neotetraose Deposited 2012-03-28	Different ligand/ion Different structure-quality metrics	Assembly 5 Other combination Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 126–398（273 aa） Fragment：catalytic domain Chain B 126–398（273 aa） Fragment：catalytic domain Chain C 126–398（273 aa） Fragment：catalytic domain	Mutation：R337T, C338T, M340H Mutation：R337T, C338T, M340H Mutation：R337T, C338T, M340H	UDP URIDINE-5'-DIPHOSPHATE × 3 MN MANGANESE (II) ION × 3 GOL GLYCEROL × 4 SO4 SULFATE ION × 11	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM mes buffer, 1.6 M ammonium sulfate, 2% dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.20 Å R-free 0.250
4EEA Crystal structure of human M340H-beta-1,4-galactosyltransferase-1 (M340H-B4GAL-T1) in complex with GLCNAC-BETA1,6-Gal-Beta1,4-Glc-BETA Deposited 2012-03-28	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 126–398（273 aa） Fragment：catalytic domain	Mutation：R337T, C338T, M340H	UDP URIDINE-5'-DIPHOSPHATE × 1 MN MANGANESE (II) ION × 1 GOL GLYCEROL × 1 SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 MM Mes buffer, 1.6 M ammonium sulfate, 2% dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.00 Å R-free 0.240
4EEA Crystal structure of human M340H-beta-1,4-galactosyltransferase-1 (M340H-B4GAL-T1) in complex with GLCNAC-BETA1,6-Gal-Beta1,4-Glc-BETA Deposited 2012-03-28	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain B 126–398（273 aa） Fragment：catalytic domain	Mutation：R337T, C338T, M340H	UDP URIDINE-5'-DIPHOSPHATE × 1 MN MANGANESE (II) ION × 1 GOL GLYCEROL × 2 SO4 SULFATE ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 MM Mes buffer, 1.6 M ammonium sulfate, 2% dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.00 Å R-free 0.240
4EEA Crystal structure of human M340H-beta-1,4-galactosyltransferase-1 (M340H-B4GAL-T1) in complex with GLCNAC-BETA1,6-Gal-Beta1,4-Glc-BETA Deposited 2012-03-28	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain C 126–398（273 aa） Fragment：catalytic domain	Mutation：R337T, C338T, M340H	UDP URIDINE-5'-DIPHOSPHATE × 1 MN MANGANESE (II) ION × 1 GOL GLYCEROL × 1 SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 MM Mes buffer, 1.6 M ammonium sulfate, 2% dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.00 Å R-free 0.240
4EEA Crystal structure of human M340H-beta-1,4-galactosyltransferase-1 (M340H-B4GAL-T1) in complex with GLCNAC-BETA1,6-Gal-Beta1,4-Glc-BETA Deposited 2012-03-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 126–398（273 aa） Fragment：catalytic domain Chain B 126–398（273 aa） Fragment：catalytic domain Chain C 126–398（273 aa） Fragment：catalytic domain	Mutation：R337T, C338T, M340H Mutation：R337T, C338T, M340H Mutation：R337T, C338T, M340H	UDP URIDINE-5'-DIPHOSPHATE × 6 MN MANGANESE (II) ION × 6 GOL GLYCEROL × 8 SO4 SULFATE ION × 40	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 MM Mes buffer, 1.6 M ammonium sulfate, 2% dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.00 Å R-free 0.240
4EEA Crystal structure of human M340H-beta-1,4-galactosyltransferase-1 (M340H-B4GAL-T1) in complex with GLCNAC-BETA1,6-Gal-Beta1,4-Glc-BETA Deposited 2012-03-28	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Other combination Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 126–398（273 aa） Fragment：catalytic domain Chain B 126–398（273 aa） Fragment：catalytic domain Chain C 126–398（273 aa） Fragment：catalytic domain	Mutation：R337T, C338T, M340H Mutation：R337T, C338T, M340H Mutation：R337T, C338T, M340H	UDP URIDINE-5'-DIPHOSPHATE × 3 MN MANGANESE (II) ION × 3 GOL GLYCEROL × 4 SO4 SULFATE ION × 20	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 MM Mes buffer, 1.6 M ammonium sulfate, 2% dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.00 Å R-free 0.240
4EEG Crystal structure of human M340H-beta-1,4-galactosyltransferase-1 (M340H-B4GAL-T1) in complex with GLCNAC-BETA1,6-Gal-Beta Deposited 2012-03-28	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 126–398（273 aa） Fragment：catalytic domain	Mutation：R337T, C338T, M340H	UDP URIDINE-5'-DIPHOSPHATE × 1 MN MANGANESE (II) ION × 1 GOL GLYCEROL × 1 SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM Mes buffer, 1.6 M Ammonium sulfate, 2% Dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.20 Å R-free 0.244
4EEG Crystal structure of human M340H-beta-1,4-galactosyltransferase-1 (M340H-B4GAL-T1) in complex with GLCNAC-BETA1,6-Gal-Beta Deposited 2012-03-28	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain B 126–398（273 aa） Fragment：catalytic domain	Mutation：R337T, C338T, M340H	UDP URIDINE-5'-DIPHOSPHATE × 1 MN MANGANESE (II) ION × 1 GOL GLYCEROL × 2 SO4 SULFATE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM Mes buffer, 1.6 M Ammonium sulfate, 2% Dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.20 Å R-free 0.244
4EEG Crystal structure of human M340H-beta-1,4-galactosyltransferase-1 (M340H-B4GAL-T1) in complex with GLCNAC-BETA1,6-Gal-Beta Deposited 2012-03-28	Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain C 126–398（273 aa） Fragment：catalytic domain	Mutation：R337T, C338T, M340H	UDP URIDINE-5'-DIPHOSPHATE × 1 MN MANGANESE (II) ION × 1 GOL GLYCEROL × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM Mes buffer, 1.6 M Ammonium sulfate, 2% Dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.20 Å R-free 0.244
4EEG Crystal structure of human M340H-beta-1,4-galactosyltransferase-1 (M340H-B4GAL-T1) in complex with GLCNAC-BETA1,6-Gal-Beta Deposited 2012-03-28	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 126–398（273 aa） Fragment：catalytic domain Chain B 126–398（273 aa） Fragment：catalytic domain Chain C 126–398（273 aa） Fragment：catalytic domain	Mutation：R337T, C338T, M340H Mutation：R337T, C338T, M340H Mutation：R337T, C338T, M340H	UDP URIDINE-5'-DIPHOSPHATE × 3 MN MANGANESE (II) ION × 3 GOL GLYCEROL × 4 SO4 SULFATE ION × 10	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM Mes buffer, 1.6 M Ammonium sulfate, 2% Dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.20 Å R-free 0.244
4EEM Crystal structure of human M340H-beta-1,4-galactosyltransferase-1 (M340H-B4GAL-T1) in complex with GLCNAC-BETA1,6-MAN-ALPHA-methyl Deposited 2012-03-28	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 126–398（273 aa） Fragment：Catalytic domain	Mutation：R337T, C338T, M340H	UDP URIDINE-5'-DIPHOSPHATE × 1 MN MANGANESE (II) ION × 1 SO4 SULFATE ION × 4 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM Mes buffer, 1.6 M ammonium sulfate, 2% Dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.20 Å R-free 0.236
4EEM Crystal structure of human M340H-beta-1,4-galactosyltransferase-1 (M340H-B4GAL-T1) in complex with GLCNAC-BETA1,6-MAN-ALPHA-methyl Deposited 2012-03-28	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain B 126–398（273 aa） Fragment：Catalytic domain	Mutation：R337T, C338T, M340H	UDP URIDINE-5'-DIPHOSPHATE × 1 MN MANGANESE (II) ION × 1 SO4 SULFATE ION × 7 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM Mes buffer, 1.6 M ammonium sulfate, 2% Dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.20 Å R-free 0.236
4EEM Crystal structure of human M340H-beta-1,4-galactosyltransferase-1 (M340H-B4GAL-T1) in complex with GLCNAC-BETA1,6-MAN-ALPHA-methyl Deposited 2012-03-28	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain C 126–398（273 aa） Fragment：Catalytic domain	Mutation：R337T, C338T, M340H	UDP URIDINE-5'-DIPHOSPHATE × 1 MN MANGANESE (II) ION × 1 SO4 SULFATE ION × 3 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM Mes buffer, 1.6 M ammonium sulfate, 2% Dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.20 Å R-free 0.236
4EEM Crystal structure of human M340H-beta-1,4-galactosyltransferase-1 (M340H-B4GAL-T1) in complex with GLCNAC-BETA1,6-MAN-ALPHA-methyl Deposited 2012-03-28	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 126–398（273 aa） Fragment：Catalytic domain Chain B 126–398（273 aa） Fragment：Catalytic domain Chain C 126–398（273 aa） Fragment：Catalytic domain	Mutation：R337T, C338T, M340H Mutation：R337T, C338T, M340H Mutation：R337T, C338T, M340H	UDP URIDINE-5'-DIPHOSPHATE × 3 MN MANGANESE (II) ION × 3 SO4 SULFATE ION × 14 GOL GLYCEROL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM Mes buffer, 1.6 M ammonium sulfate, 2% Dioxane, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.20 Å R-free 0.236
4L41 Human Lactose synthase: A 2:1 complex between human alpha-lactalbumin and human beta1,4-galactosyltransferase Deposited 2013-06-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 126–398（273 aa） Fragment：UNP residues 126-398	Mutation：R337T, C338T	CA CALCIUM ION × 2 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；100 mM mes buffer pH 7.0, 12% PEG 4000, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.70 Å R-free 0.237
6FWT Crystal structure of human wild type beta-1,4-galactosyltransferase-1 (B4GalT1) in apo-open monomeric form Deposited 2018-03-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 122–398（277 aa）	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.2 M Potassium Nitrate, 20% (w/v) PEG 3350	Resolution 1.84 Å R-free 0.218
6FWU Crystal structure of human wild type beta-1,4-galactosyltransferase-1 (B4GalT1) in apo-closed dimeric form Deposited 2018-03-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 126–398（273 aa） Chain B 126–398（273 aa）	Not recorded	NO3 NITRATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M Potassium Nitrate, 20% (w/v) PEG 3350	Resolution 2.35 Å R-free 0.256

18 other PDB entries and 54 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	B4GT1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 15–287； UniProt 126–398 Author chain B； PDBConstruct 15–287； UniProt 126–398 Author chain C； PDBConstruct 15–287； UniProt 126–398

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4eeo
Deposition date deposition_date	2012-03-28
Structure title title	Crystal structure of human M340H-beta-1,4-galactosyltransferase-1 (M340H-B4GAL-T1) in complex with GLCNAC-BETA1,6-GlcNAc-ALPHA-benzyl
Keywords keywords	GT-A fold, Glycosyltansferase, UDP-Galacotse, Transferase; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	32.61 Å
Radius of gyration Rg (electron density) rg_electron	31.81 Å
Forward intensity I(0) i0	157202000.00
Molecular weight molecular_weight	98508.0 kDa
Excluded volume excluded_volume	122270 Å³
Envelope volume envelope_volume	147730 Å³
Hydration-shell volume shell_volume	39025 Å³
Envelope diameter envelope_diameter	97.9 Å
Shell Rg shell_rg	38.54 Å
Envelope Rg envelope_rg	31.57 Å
Shape Rg shape_rg	31.82 Å
Total Rg total_rg	32.27 Å
Total atoms total_atoms	6913
Residues n_residues	819
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	99.0 Å
Rg (real space) rg_real	32.54 Å
Rg uncertainty (real space) rg_real_error	0.58 Å
I(0) (real space) i0_real	1.5720e+08
I(0) uncertainty (real space) i0_real_error	2.3250e+06
Rg (reciprocal space) rg_reciprocal	32.57 Å
I(0) (reciprocal space) i0_reciprocal	157200000.0000
Solution quality estimate total_estimate	0.6618
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	30.3 Å
Skewness Skewness skewness	0.153
Kurtosis Kurtosis kurtosis	-0.805
Angular range angular_range	— – 0.2450 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	46950000.0000
Real-space data points n_real_points	50
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.961; Stabil: 1.000; Sysdev: 0.242; Positv: 1.000; Valcen: 0.990; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Beta-1,4-galactosyltransferase 1
Molecular weight formula_weight	32773.2 kDa
EC 编号 ec_number	2.4.1.-, 2.4.1.22, 2.4.1.90, 2.4.1.38
Mutation mutation	R337T, C338T, M340H
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	7408

ASMTGGQQMGRGSASLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGTTRHIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 branched

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-6)-benzyl 2-acetamido-2-deoxy-alpha-D-glucopyranoside
Molecular weight formula_weight	514.5 kDa
Source method src_method	man
Copy count entity_count	3

Entity 3 Entity 3 non-polymer

Description description	URIDINE-5'-DIPHOSPHATE
Molecular weight formula_weight	404.2 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 4 Entity 4 non-polymer

Description description	MANGANESE (II) ION
Molecular weight formula_weight	54.9 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 5 Entity 5 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	11

Entity 6 Entity 6 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 7 Entity 7 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	463

▼

7. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d4eeoa_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.68 — Nucleotide-diphospho-sugar transferases
Superfamily Superfamily superfamily	c.68.1 — Nucleotide-diphospho-sugar transferases
Family Family family	c.68.1.2 — beta 1,4 galactosyltransferase (b4GalT1)

Domain ID domain_id	d4eeob_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.68 — Nucleotide-diphospho-sugar transferases
Superfamily Superfamily superfamily	c.68.1 — Nucleotide-diphospho-sugar transferases
Family Family family	c.68.1.2 — beta 1,4 galactosyltransferase (b4GalT1)

Domain ID domain_id	d4eeoc_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.68 — Nucleotide-diphospho-sugar transferases
Superfamily Superfamily superfamily	c.68.1 — Nucleotide-diphospho-sugar transferases
Family Family family	c.68.1.2 — beta 1,4 galactosyltransferase (b4GalT1)

CATH v4.4 (3 domains)

Domain ID domain_id	4eeoA00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	550 — Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A
Homologous superfamily homologous superfamily	10 — Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A

Domain ID domain_id	4eeoB00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	550 — Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A
Homologous superfamily homologous superfamily	10 — Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A

Domain ID domain_id	4eeoC00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	550 — Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A
Homologous superfamily homologous superfamily	10 — Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A

▶

8. Citations (1)

▶

Unit-cell length a length_a	107.804 Å
Unit-cell length b length_b	198.217 Å
Unit-cell length c length_c	143.732 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	—

Resolution resolution	2.300 Å
Low-resolution limit resolution_low	40.800 Å
R factor r_factor	0.2053
R_work r_work	0.2027
R_free r_free	0.2547

fit	/app/data/saxs_computation/ee/4eeo/4eeo.fit
pddf	/app/data/pr_computation/ee/4eeo/4eeo.pr.out
profile	/app/data/saxs_computation/ee/4eeo/4eeo.dat