SAXSdb — 4ekc

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Guanine nucleotide-binding protein G(q) subunit alpha

Mus musculus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 18–359	Fragment：UNP residues 18-359 Mutation：E125D, N126V, Y128D, V129Y, D130A, R183C	Regulator of G-protein signaling 2 × 1 （P41220） GDP GUANOSINE-5'-DIPHOSPHATE × 1 ALF TETRAFLUOROALUMINATE ION × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 5.5；277 K；17% PEG 3350, 200 mM NaCl, and 100 mM MES pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 7.40 Å R-free 0.220
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain C； UniProt 18–359	Fragment：UNP residues 18-359 Mutation：E125D, N126V, Y128D, V129Y, D130A, R183C	Regulator of G-protein signaling 2 × 1 （P41220） GDP GUANOSINE-5'-DIPHOSPHATE × 1 ALF TETRAFLUOROALUMINATE ION × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 5.5；277 K；17% PEG 3350, 200 mM NaCl, and 100 mM MES pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 7.40 Å R-free 0.220

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4EKC	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2BCJ Crystal Structure of G Protein-Coupled Receptor Kinase 2 in Complex with Galpha-q and Gbetagamma Subunits Deposited 2005-10-19	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain Q 37–359（323 aa）	Not recorded	MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；9% PEG8000, 1M NaCl, 0.1M MES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 3.06 Å R-free 0.292
3AH8 Structure of heterotrimeric G protein Galpha-q beta gamma in complex with an inhibitor YM-254890 Deposited 2010-04-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 37–359（323 aa） Fragment：UNP entry P10824 residues 2-28, UNP entry P21279 residues 37-359	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.1；293 K；7% PEG 4000, 30% (v/v) glycerol, 70 mM acetate-NaOH, pH 5.1, VAPOR DIFFUSION, temperature 293K	Resolution 2.90 Å R-free 0.315
4EKD Structure of human regulator of G protein signaling 2 (RGS2) in complex with murine Galpha-q(R183C) Deposited 2012-04-09	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 18–359（342 aa） Fragment：UNP residues 18-359	Mutation：E125D, N126V, Y128D, V129Y, D130A, R183C	GDP GUANOSINE-5'-DIPHOSPHATE × 1 ALF TETRAFLUOROALUMINATE ION × 1 CO COBALT (II) ION × 2 CL CHLORIDE ION × 2 MG MAGNESIUM ION × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；277 K；12% PEG 8,000, 15 mM CoCl2, 200 mM NaCl, and 100 mM MES 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.71 Å R-free 0.252
4GNK Crystal structure of Galphaq in complex with full-length human PLCbeta3 Deposited 2012-08-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 7–359（353 aa） Fragment：UNP residues 7-359	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 ALF TETRAFLUOROALUMINATE ION × 1 MG MAGNESIUM ION × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.75；277.15 K；100 mM MES pH 6.75, 100-200 mM NaCl, and 11-12% PEG 3350, VAPOR DIFFUSION, HANGING DROP, temperature 277.15K	Resolution 4.00 Å R-free 0.255
4GNK Crystal structure of Galphaq in complex with full-length human PLCbeta3 Deposited 2012-08-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 7–359（353 aa） Fragment：UNP residues 7-359	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 ALF TETRAFLUOROALUMINATE ION × 1 MG MAGNESIUM ION × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.75；277.15 K；100 mM MES pH 6.75, 100-200 mM NaCl, and 11-12% PEG 3350, VAPOR DIFFUSION, HANGING DROP, temperature 277.15K	Resolution 4.00 Å R-free 0.255
4QJ3 Structure of a fragment of human phospholipase C-beta3 delta472-559, in complex with Galphaq Deposited 2014-06-03	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 7–359（353 aa） Fragment：UNP residues 7-359	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 ALF TETRAFLUOROALUMINATE ION × 1 MG MAGNESIUM ION × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；277.15 K；100 mM BisTris, 200 mM NaCl, 5% PEG 3350, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 277.15K	Resolution 3.00 Å R-free 0.240
4QJ4 Structure of a fragment of human phospholipase C-beta3 delta472-569, bound to IP3 and in complex with Galphaq Deposited 2014-06-03	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 7–359（353 aa） Fragment：UNP residues 7-359	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 ALF TETRAFLUOROALUMINATE ION × 1 MG MAGNESIUM ION × 1 CA CALCIUM ION × 1 I3P D-MYO-INOSITOL-1,4,5-TRIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277.15 K；100 mM BisTris, 200 mM NaCl, 8% (v/v) PEG 3350, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277.15K	Resolution 3.30 Å R-free 0.267
4QJ5 Structure of a fragment of human phospholipase C-beta3 delta472-581, bound to IP3 and in complex with Galphaq Deposited 2014-06-03	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 7–359（353 aa） Fragment：UNP residues 7-359	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 ALF TETRAFLUOROALUMINATE ION × 1 MG MAGNESIUM ION × 1 CA CALCIUM ION × 1 I3P D-MYO-INOSITOL-1,4,5-TRIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.25；277.15 K；100 mM MES, 200 mM NaCl, 5% (v/v) PEG 3350, pH 6.25, VAPOR DIFFUSION, HANGING DROP, temperature 277.15K	Resolution 3.41 Å R-free 0.277
5DO9 Structure of regulator of G protein signaling 8 (RGS8) in complex with AlF4-activated Galpha-q Deposited 2015-09-10	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 37–350（314 aa） Fragment：Guanine nucleotide-binding protein G(q) subunit alpha	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 ALF TETRAFLUOROALUMINATE ION × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；277.15 K；Ammonium acetate, BisTris pH 5.5, PEG 8000	Resolution 2.60 Å R-free 0.226
5DO9 Structure of regulator of G protein signaling 8 (RGS8) in complex with AlF4-activated Galpha-q Deposited 2015-09-10	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 37–350（314 aa） Fragment：Guanine nucleotide-binding protein G(q) subunit alpha	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 ALF TETRAFLUOROALUMINATE ION × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；277.15 K；Ammonium acetate, BisTris pH 5.5, PEG 8000	Resolution 2.60 Å R-free 0.226
5DO9 Structure of regulator of G protein signaling 8 (RGS8) in complex with AlF4-activated Galpha-q Deposited 2015-09-10	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 37–350（314 aa） Fragment：Guanine nucleotide-binding protein G(q) subunit alpha	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 ALF TETRAFLUOROALUMINATE ION × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；277.15 K；Ammonium acetate, BisTris pH 5.5, PEG 8000	Resolution 2.60 Å R-free 0.226
5DO9 Structure of regulator of G protein signaling 8 (RGS8) in complex with AlF4-activated Galpha-q Deposited 2015-09-10	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 37–350（314 aa） Fragment：Guanine nucleotide-binding protein G(q) subunit alpha	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 ALF TETRAFLUOROALUMINATE ION × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；277.15 K；Ammonium acetate, BisTris pH 5.5, PEG 8000	Resolution 2.60 Å R-free 0.226
5DO9 Structure of regulator of G protein signaling 8 (RGS8) in complex with AlF4-activated Galpha-q Deposited 2015-09-10	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 37–350（314 aa） Fragment：Guanine nucleotide-binding protein G(q) subunit alpha	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 ALF TETRAFLUOROALUMINATE ION × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；277.15 K；Ammonium acetate, BisTris pH 5.5, PEG 8000	Resolution 2.60 Å R-free 0.226
5DO9 Structure of regulator of G protein signaling 8 (RGS8) in complex with AlF4-activated Galpha-q Deposited 2015-09-10	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 37–350（314 aa） Fragment：Guanine nucleotide-binding protein G(q) subunit alpha	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 ALF TETRAFLUOROALUMINATE ION × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；277.15 K；Ammonium acetate, BisTris pH 5.5, PEG 8000	Resolution 2.60 Å R-free 0.226
7SQ2 Reprocessed and refined structure of Phospholipase C-beta and Gq signaling complex Deposited 2021-11-04	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 35–359（325 aa）	Not recorded	ALF TETRAFLUOROALUMINATE ION × 1 MG MAGNESIUM ION × 2 GDP GUANOSINE-5'-DIPHOSPHATE × 1 ACT ACETATE ION × 7 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；291 K；7% PEG 6000, 100 mM Hepes, 1 mM CaCl2, 100 mM magnesium acetate	Resolution 2.60 Å R-free 0.263

9 other PDB entries and 15 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	GNAQ_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 6–347； UniProt 18–359 Author chain C； PDBConstruct 6–347； UniProt 18–359

Regulator of G-protein signaling 2

Homo sapiens

UniProt P41220

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 72–203	Fragment：RGS domain, UNP residues 72-203	Guanine nucleotide-binding protein G(q) subunit alpha × 1 （P21279） GDP GUANOSINE-5'-DIPHOSPHATE × 1 ALF TETRAFLUOROALUMINATE ION × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 5.5；277 K；17% PEG 3350, 200 mM NaCl, and 100 mM MES pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 7.40 Å R-free 0.220
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain D； UniProt 72–203	Fragment：RGS domain, UNP residues 72-203	Guanine nucleotide-binding protein G(q) subunit alpha × 1 （P21279） GDP GUANOSINE-5'-DIPHOSPHATE × 1 ALF TETRAFLUOROALUMINATE ION × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 5.5；277 K；17% PEG 3350, 200 mM NaCl, and 100 mM MES pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 7.40 Å R-free 0.220

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4EKC	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2AF0 Structure of the Regulator of G-Protein Signaling Domain of RGS2 Deposited 2005-07-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 71–203（133 aa） Fragment：residues 71-203	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；(NH4)2SO4, NaCl, cacodylate, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.30 Å R-free 0.256
2V4Z The crystal structure of the human G-protein subunit alpha (GNAI3) in complex with an engineered regulator of G-protein signaling type 2 domain (RGS2) Deposited 2008-09-30	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 71–209（139 aa） Fragment：RGS DOMAIN, RESIDUES 71-209	Mutation：YES	GDP GUANOSINE-5'-DIPHOSPHATE × 1 ALF TETRAFLUOROALUMINATE ION × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；0.1 M HEPES PH 7.5, 2 M AMMONIUM SULPHATE	Resolution 2.80 Å R-free 0.254
4EKD Structure of human regulator of G protein signaling 2 (RGS2) in complex with murine Galpha-q(R183C) Deposited 2012-04-09	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 72–203（132 aa） Fragment：RGS domain, UNP residues 72-203	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 ALF TETRAFLUOROALUMINATE ION × 1 CO COBALT (II) ION × 2 CL CHLORIDE ION × 2 MG MAGNESIUM ION × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；277 K；12% PEG 8,000, 15 mM CoCl2, 200 mM NaCl, and 100 mM MES 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.71 Å R-free 0.252

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RGS2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 6–137； UniProt 72–203 Author chain D； PDBConstruct 6–137； UniProt 72–203

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4ekc
Deposition date deposition_date	2012-04-09
Structure title title	Structure of human regulator of G protein signaling 2 (RGS2) in complex with murine Galpha-q(R183C)
Keywords keywords	;GTP-binding protein fold, Regulator, G protein signaling, RGS, homology domain, GTPase activation, SIGNALING PROTEIN-INHIBITOR complex ;; SIGNALING PROTEIN/INHIBITOR
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	37.58 Å
Radius of gyration Rg (electron density) rg_electron	37.82 Å
Forward intensity I(0) i0	166879000.00
Molecular weight molecular_weight	104980.0 kDa
Excluded volume excluded_volume	131450 Å³
Envelope volume envelope_volume	179860 Å³
Hydration-shell volume shell_volume	40799 Å³
Envelope diameter envelope_diameter	129.9 Å
Shell Rg shell_rg	42.41 Å
Envelope Rg envelope_rg	37.48 Å
Shape Rg shape_rg	37.83 Å
Total Rg total_rg	38.09 Å
Total atoms total_atoms	7386
Residues n_residues	890
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	121.2 Å
Rg (real space) rg_real	37.82 Å
Rg uncertainty (real space) rg_real_error	0.89 Å
I(0) (real space) i0_real	1.6690e+08
I(0) uncertainty (real space) i0_real_error	2.9300e+06
Rg (reciprocal space) rg_reciprocal	37.68 Å
I(0) (reciprocal space) i0_reciprocal	166900000.0000
Solution quality estimate total_estimate	0.8341
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	31.8 Å
Skewness Skewness skewness	0.375
Kurtosis Kurtosis kurtosis	-0.741
Angular range angular_range	— – 0.2100 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	41210000.0000
Real-space data points n_real_points	43
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.747; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.875; Smooth: 0.723

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Guanine nucleotide-binding protein G(q) subunit alpha
Molecular weight formula_weight	40634.2 kDa
EC 编号 ec_number	3.6.5.1
Mutation mutation	E125D, N126V, Y128D, V129Y, D130A, R183C
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	7392

GAMGSARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFDVPDYAAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVCVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Trichoplusia ni

Entity 2 Entity 2 polymer

Description description	Regulator of G-protein signaling 2
Molecular weight formula_weight	15871.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

GEFGSPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDLCKKPQ

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	GUANOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	443.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 non-polymer

Description description	TETRAFLUOROALUMINATE ION
Molecular weight formula_weight	103.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 5 Entity 5 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	6

▶

8. Citations (1)

▶

Unit-cell length a length_a	139.603 Å
Unit-cell length b length_b	124.983 Å
Unit-cell length c length_c	97.196 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	124.13 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	7.400 Å
Low-resolution limit resolution_low	19.980 Å
R factor r_factor	0.1608
R_work r_work	0.1580
R_free r_free	0.2204

fit	/app/data/saxs_computation/ek/4ekc/4ekc.fit
pddf	/app/data/pr_computation/ek/4ekc/4ekc.pr.out
profile	/app/data/saxs_computation/ek/4ekc/4ekc.dat

Structure of human regulator of G protein signaling 2 (RGS2) in complex with murine Galpha-q(R183C)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Guanine nucleotide-binding protein G(q) subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Regulator of G-protein signaling 2

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)