SAXSdb — 4f2c

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

CDGSH iron-sulfur domain-containing protein 1

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	FE2/S2 (INORGANIC) CLUSTER × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CISD1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–76； UniProt 33–108 Author chain B； PDBConstruct 1–76； UniProt 33–108

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4f2c
Deposition date deposition_date	2012-05-07
Structure title title	The Crystal Structure of a Human MitoNEET double mutant in which Gly 66 are Asp 67 are both Replaced with Ala Residues
Keywords keywords	MITOCHONDRIAL OUTER MEMBRANE, SIGNAL-ANCHOR, TRANSMEMBRANE METAL BINDING PROTEIN, PROTEIN FRUSTRATION, METAL BINDING PROTEIN; METAL BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4f2c__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4f2c__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4f2c__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	15.40 Å
Rg (electron density)	14.35 Å
Total Rg	15.35 Å
Atom count	1066
Residues	133
Excluded volume	19003 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4f2c__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	CDGSH iron-sulfur domain-containing protein 1
Molecular weight formula_weight	8918.3 kDa
Mutation mutation	G66A,D67A
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	1308

RFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLAAKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	185

▼

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d4f2ca_
Class class	g — Small proteins
Fold Fold fold	g.97 — Iron-sulfur cluster-binding zinc finger CDGSH type
Superfamily Superfamily superfamily	g.97.1 — Iron-sulfur cluster-binding zinc finger CDGSH type
Family Family family	g.97.1.1 — Outer mitochondrial membrane protein mitoNEET-like

Domain ID domain_id	d4f2cb_
Class class	g — Small proteins
Fold Fold fold	g.97 — Iron-sulfur cluster-binding zinc finger CDGSH type
Superfamily Superfamily superfamily	g.97.1 — Iron-sulfur cluster-binding zinc finger CDGSH type
Family Family family	g.97.1.1 — Outer mitochondrial membrane protein mitoNEET-like

▶

Unit-cell length a length_a	45.632 Å
Unit-cell length b length_b	51.995 Å
Unit-cell length c length_c	59.018 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.350 Å
Low-resolution limit resolution_low	39.014 Å
R factor r_factor	0.1540
R_work r_work	0.1526
R_free r_free	0.1812

The Crystal Structure of a Human MitoNEET double mutant in which Gly 66 are Asp 67 are both Replaced with Ala Residues

1. Protein Identity and Related Structures Protein Identity & Related Structures

CDGSH iron-sulfur domain-containing protein 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4f2c__assembly_1__model_1

4f2c__assembly_1__model_1 | I(q)

4f2c__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (2 domains)

7. Citations (1)

The Crystal Structure of a Human MitoNEET double mutant in which Gly 66 are Asp 67 are both Replaced with Ala Residues

1. Protein Identity and Related Structures Protein Identity & Related Structures

CDGSH iron-sulfur domain-containing protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4f2c__assembly_1__model_1

4f2c__assembly_1__model_1 | I(q)

4f2c__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (2 domains)

7. Citations (1)