SAXSdb — 4fq0

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar motor switch protein

Helicobacter pylori

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Flagellar motor switch protein × 1 （O25119） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Flagellar motor switch protein × 1 （O25119） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	O25675_HELPY
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 6–210； UniProt 33–237 Author chain B； PDBConstruct 6–210； UniProt 33–237

Flagellar motor switch protein

Helicobacter pylori

UniProt O25119

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Flagellar motor switch protein × 1 （O25675） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Flagellar motor switch protein × 1 （O25675） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	O25119_HELPY
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 22–111； UniProt 116–205 Author chain D； PDBConstruct 22–111； UniProt 116–205

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4fq0
Deposition date deposition_date	2012-06-24
Structure title title	Crystal structure of FliG-FliM complex from H. pylori
Keywords keywords	flagellar motor switch complex, FliG-FliM-FliN, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4fq0__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4fq0__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4fq0__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	20.80 Å
Rg (electron density)	19.92 Å
Total Rg	20.68 Å
Atom count	1983
Residues	262
Excluded volume	35643 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4fq0__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4fq0__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Flagellar motor switch protein
Molecular weight formula_weight	23550.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,A
Atom count atom_count	3974

GPLGSPQRSVTLYDFKRPNRVSKEQLRSFRSIHDKMARNLSSQVSSIMRSIVEIQLHSVDQMTYGEFLMSLPSPTSFNVFSMKPMGGTGVLEINPSIAFPMIDRLLGGKGSAYDQNREFSDIELNLLDTILRQVMQILKEVWSPVVEMFPTIDAKESSANVVQIVAQNEISIMVVLEIIIGHSRGMMNICYPVISIESILSKMGSRDLML

Source Source

Source organism organism	Helicobacter pylori
NCBI taxonomy ID ncbi_taxonomy_id	85962
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Flagellar motor switch protein
Molecular weight formula_weight	12488.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

HHHHHHHMASMTGGQQMGRGSQKNFAYLGKIKPQQLADFIINEHPQTIALILAHMEAPNAAETLSYFPDEMKAEISIRMANLGEISPQVVKRVSTVLENKLESLTSYKIEV

Source Source

Source organism organism	Helicobacter pylori
NCBI taxonomy ID ncbi_taxonomy_id	85962
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	9

▼

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	4fq0A00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1550 — Chemotaxis protein chec
Homologous superfamily homologous superfamily	10 — CheC-like

Domain ID domain_id	4fq0B00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1550 — Chemotaxis protein chec
Homologous superfamily homologous superfamily	10 — CheC-like

Domain ID domain_id	4fq0C00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	220 — Annexin V; domain 1
Homologous superfamily homologous superfamily	30 — Flagellar motor switch protein FliG, alpha-alpha superhelical domain

Domain ID domain_id	4fq0D00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	220 — Annexin V; domain 1
Homologous superfamily homologous superfamily	30 — Flagellar motor switch protein FliG, alpha-alpha superhelical domain

▶

Unit-cell length a length_a	40.085 Å
Unit-cell length b length_b	124.540 Å
Unit-cell length c length_c	137.739 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.820 Å
Low-resolution limit resolution_low	36.770 Å
R factor r_factor	0.2412
R_work r_work	0.2374
R_free r_free	0.3079

Crystal structure of FliG-FliM complex from H. pylori

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar motor switch protein

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar motor switch protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4fq0__assembly_1__model_1

4fq0__assembly_1__model_1 | I(q)

4fq0__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)

Crystal structure of FliG-FliM complex from H. pylori

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar motor switch protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Flagellar motor switch protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4fq0__assembly_1__model_1

4fq0__assembly_1__model_1 | I(q)

4fq0__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)