SAXSdb — 4gn0

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hamp domain of AF1503

Archaeoglobus fulgidus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	MAGNESIUM ION × 1 water × 2	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	water × 2	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 4	MAGNESIUM ION × 1 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	O28769_ARCFU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–105； UniProt 234–338 Author chain B； PDBConstruct 1–105； UniProt 234–338 Author chain C； PDBConstruct 1–105； UniProt 234–338 Author chain D； PDBConstruct 1–105； UniProt 234–338

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4gn0
Deposition date deposition_date	2012-08-16
Structure title title	De novo phasing of a Hamp-complex using an improved Arcimboldo method
Keywords keywords	Four helix bundle, Hamp domain, Transmembrane signalling, SIGNALING PROTEIN; SIGNALING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4gn0__assembly_3__model_1

Assembly 3 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4gn0__assembly_3__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4gn0__assembly_3__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	40.89 Å
Rg (electron density)	42.30 Å
Total Rg	41.92 Å
Atom count	3130
Residues	412
Excluded volume	55653 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4gn0__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4gn0__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`4gn0__assembly_3__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Hamp domain of AF1503
Molecular weight formula_weight	11389.8 kDa
Mutation mutation	Y255K, Y256N, A257L, G259T, I260L, A263D, I264R, I266E, V267Q, F268I, I270N, V271D, V274S, F275T
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	3503

NPAENIASEISKSVEGAIQQVKNLLTLAADRAEQIVNDLASTTTSTITRPIIELSNTADKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAMESLEEALK

Source Source

Source organism organism	Archaeoglobus fulgidus
NCBI taxonomy ID ncbi_taxonomy_id	224325
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	373

▼

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	4gn0A00
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	340 — hypothetical protein mp506/mpn330, domain 1
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	4gn0B00
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	340 — hypothetical protein mp506/mpn330, domain 1
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	4gn0C00
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	340 — hypothetical protein mp506/mpn330, domain 1
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	4gn0D00
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	340 — hypothetical protein mp506/mpn330, domain 1
Homologous superfamily homologous superfamily	10 —

▶

Unit-cell length a length_a	44.115 Å
Unit-cell length b length_b	48.077 Å
Unit-cell length c length_c	95.262 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	98.02 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.750 Å
Low-resolution limit resolution_low	41.930 Å
R factor r_factor	0.1942
R_work r_work	0.1926
R_free r_free	0.2241

De novo phasing of a Hamp-complex using an improved Arcimboldo method

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hamp domain of AF1503

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4gn0__assembly_3__model_1

4gn0__assembly_3__model_1 | I(q)

4gn0__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)

De novo phasing of a Hamp-complex using an improved Arcimboldo method

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hamp domain of AF1503

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4gn0__assembly_3__model_1

4gn0__assembly_3__model_1 | I(q)

4gn0__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)