SAXSdb — 4h63

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mediator of RNA polymerase II transcription subunit 6

Schizosaccharomyces pombe

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Mediator of RNA polymerase II transcription subunit 8 × 1 （O94646） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q9P6Q0） Mediator of RNA polymerase II transcription subunit 17 × 1 （P87306） Mediator of RNA polymerase II transcription subunit 18 × 1 （O14198） Mediator of RNA polymerase II transcription subunit 22 × 1 （O14010）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED6_SCHPO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain F； PDBConstruct 4–183； UniProt 1–180

Mediator of RNA polymerase II transcription subunit 8

Schizosaccharomyces pombe

UniProt O94646

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Mediator of RNA polymerase II transcription subunit 6 × 1 （Q9US45） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q9P6Q0） Mediator of RNA polymerase II transcription subunit 17 × 1 （P87306） Mediator of RNA polymerase II transcription subunit 18 × 1 （O14198） Mediator of RNA polymerase II transcription subunit 22 × 1 （O14010）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED8_SCHPO
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain H； PDBConstruct 1–200； UniProt 1–200

Mediator of RNA polymerase II transcription subunit 11

Schizosaccharomyces pombe

UniProt Q9P6Q0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Mediator of RNA polymerase II transcription subunit 6 × 1 （Q9US45） Mediator of RNA polymerase II transcription subunit 8 × 1 （O94646） Mediator of RNA polymerase II transcription subunit 17 × 1 （P87306） Mediator of RNA polymerase II transcription subunit 18 × 1 （O14198） Mediator of RNA polymerase II transcription subunit 22 × 1 （O14010）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED11_SCHPO
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain K； PDBConstruct 1–112； UniProt 1–112

Mediator of RNA polymerase II transcription subunit 17

Schizosaccharomyces pombe

UniProt P87306

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Mediator of RNA polymerase II transcription subunit 6 × 1 （Q9US45） Mediator of RNA polymerase II transcription subunit 8 × 1 （O94646） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q9P6Q0） Mediator of RNA polymerase II transcription subunit 18 × 1 （O14198） Mediator of RNA polymerase II transcription subunit 22 × 1 （O14010）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED17_SCHPO
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain Q； PDBConstruct 2–469； UniProt 78–545

Mediator of RNA polymerase II transcription subunit 18

Schizosaccharomyces pombe

UniProt O14198

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Mediator of RNA polymerase II transcription subunit 6 × 1 （Q9US45） Mediator of RNA polymerase II transcription subunit 8 × 1 （O94646） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q9P6Q0） Mediator of RNA polymerase II transcription subunit 17 × 1 （P87306） Mediator of RNA polymerase II transcription subunit 22 × 1 （O14010）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED18_SCHPO
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain R； PDBConstruct 3–209； UniProt 1–207

Mediator of RNA polymerase II transcription subunit 22

Schizosaccharomyces pombe

UniProt O14010

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Mediator of RNA polymerase II transcription subunit 6 × 1 （Q9US45） Mediator of RNA polymerase II transcription subunit 8 × 1 （O94646） Mediator of RNA polymerase II transcription subunit 11 × 1 （Q9P6Q0） Mediator of RNA polymerase II transcription subunit 17 × 1 （P87306） Mediator of RNA polymerase II transcription subunit 18 × 1 （O14198）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MED22_SCHPO
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain V； PDBConstruct 1–135； UniProt 2–136

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4h63
Deposition date deposition_date	2012-09-19
Structure title title	Structure of the Schizosaccharomyces pombe Mediator head module
Keywords keywords	TRANSCRIPTION, MEDIATOR COMPLEX, NUCLEUS; TRANSCRIPTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4h63__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4h63__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4h63__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	47.03 Å
Rg (electron density)	47.69 Å
Total Rg	47.59 Å
Atom count	9254
Residues	1136
Excluded volume	165140 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4h63__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Mediator of RNA polymerase II transcription subunit 6
Molecular weight formula_weight	21163.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F
Atom count atom_count	9254

GSHMASGAPPSVDLTSIQWRMPEWVQSMGGLRTENVLEYFSQSPFYSHKSNNEMLKMQSQFNALDLGDLNSQLKRLTGIQFVIIHERPPFLWVIQKQNRLNENEVKPLTVYFVCNENIYMAPNAYTLLATRMLNATYCFQKALTKIEKFPQYNPQEGYTYPKLSNDNLEVDHSNTNEPADENK

Source Source

Source organism organism	Schizosaccharomyces pombe
Common name common_name	Fission yeast
NCBI taxonomy ID ncbi_taxonomy_id	284812
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Mediator of RNA polymerase II transcription subunit 8
Molecular weight formula_weight	23360.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MEDISTEKTVESLEAIRHRIAQIVQSLTHFLAILHQSESLSPWPTIHKNFNILLSQIHSLSNNLAAHSHTLQTTSIYPSLEFPVKEQEPLLTTLLRTKALPEVEEWEANTLQEYEASISSQPKKKEANDAYQKDQLWDQARIIFMEERENYSWFDFVTRRQESEGEFVSQRQLEIDRATEEQNANQMLTDILSFMKSGKR

Source Source

Source organism organism	Schizosaccharomyces pombe
Common name common_name	Fission yeast
NCBI taxonomy ID ncbi_taxonomy_id	284812
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Mediator of RNA polymerase II transcription subunit 11
Molecular weight formula_weight	12644.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MTNSDDDLFSEKSTSSDTQQVQNILELEAKIPDILSSAGKCIEAIQLNNSLEDFRKYSKEFLETVEFISTGLRRQALELEKAEVPVVSLQPKKRYASTPLSNLIFDQSSKLM

Source Source

Source organism organism	Schizosaccharomyces pombe
Common name common_name	Fission yeast
NCBI taxonomy ID ncbi_taxonomy_id	284812
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	Mediator of RNA polymerase II transcription subunit 17
Molecular weight formula_weight	53877.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

GNVLEFATLDSKRNVNDTEVESMDSQAYKKELIEQIMIAQTECSLALDMTSLLLSKFKENSIETISPFLKSTVPPSSLQFSRSQPPESKESDATLAKCWKEKSLTSSCKFLFEAKERLTSVVETEHEYYTELVKVKEASWPLFNSQGSNHLSVQYSCLGGISLGLGLIRMKPESKSFEVQSSLLYSQAALKISILNKDRDEIGSSTWSWPSQNCNSVLLKDIYKLQEILFEMDIWNSLLQEAQSCGNQGVNFTGDEILVPISDDHVVRITLETSSKNTESGFTEDKKSNEDTSTNFVTIKQEKELLKCLCDTLNAIAHILFLKHCRKSDRRSQQPELYMAIDANAPLILRPLIFYYNLNQESLEFQRWLKQRDISFKFMPNYPWEKAKDFLELENSLSINRLSISWRIMVSNFEPAIFIQHTPTLHGTDKSVWRCKDQYSSNQFSSLKNVCQYIEHHINSLSRRSKKTE

Source Source

Source organism organism	Schizosaccharomyces pombe
Common name common_name	Fission yeast
NCBI taxonomy ID ncbi_taxonomy_id	284812
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	Mediator of RNA polymerase II transcription subunit 18
Molecular weight formula_weight	24214.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

ASMQELYLLGVVPSRRFEAVVNSLSKTLDGPKTILEFWVVYRPKDVPPNLPRQPDSWLRLCSNIESHDETDTEWSKNTQWSMYLEGNSEPKREDKCGIRPVNRAKLTNGSVTEFVEKMGYEFSHEYIIQGLEYFFFDTTVRIYQTLIPSQQRSIKPPFHPMNEEQPWILHVYTHVADASNQVAMAKAEANLTKVKTLLSAFCDLKNVRL

Source Source

Source organism organism	Schizosaccharomyces pombe
Common name common_name	Fission yeast
NCBI taxonomy ID ncbi_taxonomy_id	284812
Host organism host_organism	Escherichia coli

Entity 6 Entity 6 polymer

Description description	Mediator of RNA polymerase II transcription subunit 22
Molecular weight formula_weight	15265.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

SSDSFQRQLVQRTNTLNSSIDNATLTILSRFQDILDIAINEGKDKYTVAPEVYQIECHTVSMVRAVEQLLDVSRQIKSYWLTNSLSTSFPTVDYSEPDLEKVKRTLTKLQNHLLEVSLIEPEASETTEAPTVSDT

Source Source

Source organism organism	Schizosaccharomyces pombe
Common name common_name	Fission yeast
NCBI taxonomy ID ncbi_taxonomy_id	284812
Host organism host_organism	Escherichia coli

▼

6. Fold Classification (SCOP + CATH) 9 domains

CATH v4.4 (9 domains)

Domain ID domain_id	4h63F02
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	250 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	2600 —

Domain ID domain_id	4h63H01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	58 — Methane Monooxygenase Hydroxylase; Chain G, domain 1
Homologous superfamily homologous superfamily	1710 —

Domain ID domain_id	4h63H02
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	250 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	2610 —

Domain ID domain_id	4h63H04
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	790 — Single helix bin

Domain ID domain_id	4h63K00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	3490 —

Domain ID domain_id	4h63Q01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	250 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	2620 —

Domain ID domain_id	4h63Q02
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	250 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	2630 —

Domain ID domain_id	4h63Q04
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	120 —

Domain ID domain_id	4h63R00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	320 — Hypothetical Protein Pfu-838710-001
Homologous superfamily homologous superfamily	10 — Hypothetical Protein Pfu-838710-001

▶

Unit-cell length a length_a	145.600 Å
Unit-cell length b length_b	145.600 Å
Unit-cell length c length_c	241.620 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 32 2 1
Space-group number int_tables_number	154
Crystal system crystal_system	—

Resolution resolution	3.400 Å
Low-resolution limit resolution_low	126.093 Å
R factor r_factor	0.2332
R_work r_work	0.2319
R_free r_free	0.2579

Structure of the Schizosaccharomyces pombe Mediator head module

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mediator of RNA polymerase II transcription subunit 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mediator of RNA polymerase II transcription subunit 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mediator of RNA polymerase II transcription subunit 11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mediator of RNA polymerase II transcription subunit 17

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mediator of RNA polymerase II transcription subunit 18

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mediator of RNA polymerase II transcription subunit 22

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4h63__assembly_1__model_1

4h63__assembly_1__model_1 | I(q)

4h63__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 9 domains