SAXSdb — 4in3

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chitin biosynthesis protein CHS5

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Protein BCH1 × 2 （Q05029） water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CHS5_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 6–82； UniProt 1–77 Author chain C； PDBConstruct 6–82； UniProt 1–77

Protein BCH1

Saccharomyces cerevisiae

UniProt Q05029

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Chitin biosynthesis protein CHS5 × 2 （Q12114） water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BCH1_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–724； UniProt 1–724 Author chain D； PDBConstruct 1–724； UniProt 1–724

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4in3
Deposition date deposition_date	2013-01-03
Structure title title	Crystal Structure of the Chs5-Bch1 Exomer Cargo Adaptor Complex
Keywords keywords	OB fold, TPR domain, Trans-Golgi Network, TGN, PROTEIN TRANSPORT; PROTEIN TRANSPORT
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4in3__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4in3__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4in3__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	37.89 Å
Rg (electron density)	36.98 Å
Total Rg	37.58 Å
Atom count	11069
Residues	1376
Excluded volume	199450 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4in3__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Chitin biosynthesis protein CHS5
Molecular weight formula_weight	9272.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	11087

MDPEFMSSVDVLLTVGKLDASLALLTTQDHHVIEFPTVLLPENVKAGSIIKMQVSQNLEEEKKQRNHFKSIQAKILEKYGTH

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Protein BCH1
Molecular weight formula_weight	83972.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

MLSQTSIPEVKEDVIGYALHQRRARVGQFQDLGPPDLITLIKSLPSSSSTTTATASANDNGATSNINGQDPTTIVTELHSHDKLKGQIGTFFYCMGIDTSDPTSITIFAKKITDLFLDTPQIWFGKKKHFHVSKISISSWNAFRKYDVNIIVHIPGTVQTYIINSDGEQSQLPSVAEASSGRNSQDLNVNMIWAETFMSGIVRDIMIMKDNRADGESQNLVETLIFNPFTSGELEDVANNFIKLFPLVYEKGVYLDAPTHVLNPSLTNNYLVETLVEIVRLTKSLEACRKMLKKLIEIHPEAVIILIRVYFACDLEIDAVDLINEQLNSPSSFLADDSKTSHIQLIFKSELLSIQSEFLLDVKRDYKLAKEVAMEAVNCAPNEFKTWYLLTRIYIKLNDMSNALLSLNACPMSQVKEKYVLRRIAPITSDENLHLPLPLDASIEEISSLNPMDVQLEQKSADPNLVNLSASSLKSTFQLAYKLLTEIVQITGWEQLLKYRSKIFVMEDEYQGSTSSIDEAEVRGNDISKMRSKRLCERWLDNLFMLLYEDLKTYTDWQSEQLYFDAQNSKYHKLTVEWELFGLCAKRLGHLPEAAKAFQIGLSQRFSPVCAKNLLQFYIDEHKRIRRDSVSANSELTSSQILSSINDIDSSIIDLVVKICCWNHRWYIEFSIILIDALSVAVQDMGITKVHNEIASRFSDPVAQLIDDNILNFLKNFTNDTFDNGTENLYFQGHHHHHH

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	18

▼

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	4in3A00
Class class	6 — Special
Architecture architecture	20 — Other non-globular
Topology topology	120 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	50 —

Domain ID domain_id	4in3B00
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	40 — Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
Homologous superfamily homologous superfamily	10 — Tetratricopeptide repeat domain

Domain ID domain_id	4in3C00
Class class	6 — Special
Architecture architecture	20 — Other non-globular
Topology topology	120 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	50 —

Domain ID domain_id	4in3D00
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	40 — Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
Homologous superfamily homologous superfamily	10 — Tetratricopeptide repeat domain

▶

Unit-cell length a length_a	141.391 Å
Unit-cell length b length_b	155.686 Å
Unit-cell length c length_c	99.054 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	95.34 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	2.936 Å
Low-resolution limit resolution_low	38.730 Å
R factor r_factor	0.2396
R_work r_work	0.2367
R_free r_free	0.2889

Crystal Structure of the Chs5-Bch1 Exomer Cargo Adaptor Complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chitin biosynthesis protein CHS5

State in the Current Structure

Other States of the Same Protein in the Database

Protein BCH1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4in3__assembly_1__model_1

4in3__assembly_1__model_1 | I(q)

4in3__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)

Crystal Structure of the Chs5-Bch1 Exomer Cargo Adaptor Complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chitin biosynthesis protein CHS5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein BCH1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4in3__assembly_1__model_1

4in3__assembly_1__model_1 | I(q)

4in3__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)