4kt0

Crystal structure of a virus like photosystem I from the cyanobacterium Synechocystis PCC 6803

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

Synechocystis sp. PCC 6803

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Photosystem I subunit III × 1 （L8AII8） Photosystem I reaction center subunit IX × 1 （L8AGL9） Photosystem I reaction center subunit PsaK × 1 （L8APJ0） Photosystem I reaction center subunit XII × 1 （L8ADF9） PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 CHLOROPHYLL A ISOMER × 2 BETA-CAROTENE × 17 CHLOROPHYLL A × 90 DODECYL-ALPHA-D-MALTOSIDE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHLORIDE ION × 1 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	L8AHT3_9SYNC
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–751； UniProt 1–751

Photosystem I P700 chlorophyll a apoprotein A2

Synechocystis sp. PCC 6803

UniProt L8AIC0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Photosystem I subunit III × 1 （L8AII8） Photosystem I reaction center subunit IX × 1 （L8AGL9） Photosystem I reaction center subunit PsaK × 1 （L8APJ0） Photosystem I reaction center subunit XII × 1 （L8ADF9） PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 CHLOROPHYLL A ISOMER × 2 BETA-CAROTENE × 17 CHLOROPHYLL A × 90 DODECYL-ALPHA-D-MALTOSIDE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHLORIDE ION × 1 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	L8AIC0_9SYNC
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–731； UniProt 1–731

Photosystem I iron-sulfur center

Synechocystis sp. PCC 6803

UniProt L8AST2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Photosystem I subunit III × 1 （L8AII8） Photosystem I reaction center subunit IX × 1 （L8AGL9） Photosystem I reaction center subunit PsaK × 1 （L8APJ0） Photosystem I reaction center subunit XII × 1 （L8ADF9） PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 CHLOROPHYLL A ISOMER × 2 BETA-CAROTENE × 17 CHLOROPHYLL A × 90 DODECYL-ALPHA-D-MALTOSIDE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHLORIDE ION × 1 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	L8AST2_9SYNC
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–81； UniProt 1–81

Photosystem I subunit II

Synechocystis sp. PCC 6803

UniProt L8AFM8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I reaction center subunit IV × 1 （L8ASH8） Photosystem I subunit III × 1 （L8AII8） Photosystem I reaction center subunit IX × 1 （L8AGL9） Photosystem I reaction center subunit PsaK × 1 （L8APJ0） Photosystem I reaction center subunit XII × 1 （L8ADF9） PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 CHLOROPHYLL A ISOMER × 2 BETA-CAROTENE × 17 CHLOROPHYLL A × 90 DODECYL-ALPHA-D-MALTOSIDE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHLORIDE ION × 1 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	L8AFM8_9SYNC
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–141； UniProt 1–141

Photosystem I reaction center subunit IV

Synechocystis sp. PCC 6803

UniProt L8ASH8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Photosystem I subunit III × 1 （L8AII8） Photosystem I reaction center subunit IX × 1 （L8AGL9） Photosystem I reaction center subunit PsaK × 1 （L8APJ0） Photosystem I reaction center subunit XII × 1 （L8ADF9） PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 CHLOROPHYLL A ISOMER × 2 BETA-CAROTENE × 17 CHLOROPHYLL A × 90 DODECYL-ALPHA-D-MALTOSIDE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHLORIDE ION × 1 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	L8ASH8_9SYNC
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–74； UniProt 1–74

Photosystem I subunit III

Synechocystis sp. PCC 6803

UniProt L8AII8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Photosystem I reaction center subunit IX × 1 （L8AGL9） Photosystem I reaction center subunit PsaK × 1 （L8APJ0） Photosystem I reaction center subunit XII × 1 （L8ADF9） PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 CHLOROPHYLL A ISOMER × 2 BETA-CAROTENE × 17 CHLOROPHYLL A × 90 DODECYL-ALPHA-D-MALTOSIDE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHLORIDE ION × 1 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	L8AII8_9SYNC
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–165； UniProt 20–184

Photosystem I reaction center subunit IX

Synechocystis sp. PCC 6803

UniProt L8AGL9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Photosystem I subunit III × 1 （L8AII8） Photosystem I reaction center subunit PsaK × 1 （L8APJ0） Photosystem I reaction center subunit XII × 1 （L8ADF9） PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 CHLOROPHYLL A ISOMER × 2 BETA-CAROTENE × 17 CHLOROPHYLL A × 90 DODECYL-ALPHA-D-MALTOSIDE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHLORIDE ION × 1 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	L8AGL9_9SYNC
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain J； PDBConstruct 1–40； UniProt 1–40

Photosystem I reaction center subunit PsaK

Synechocystis sp. PCC 6803

UniProt L8APJ0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Photosystem I subunit III × 1 （L8AII8） Photosystem I reaction center subunit IX × 1 （L8AGL9） Photosystem I reaction center subunit XII × 1 （L8ADF9） PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 CHLOROPHYLL A ISOMER × 2 BETA-CAROTENE × 17 CHLOROPHYLL A × 90 DODECYL-ALPHA-D-MALTOSIDE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHLORIDE ION × 1 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	L8APJ0_9SYNC
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain K； PDBConstruct 1–128； UniProt 1–128

Photosystem I reaction center subunit XII

Synechocystis sp. PCC 6803

UniProt L8ADF9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （L8AHT3） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （L8AIC0） Photosystem I iron-sulfur center × 1 （L8AST2） Photosystem I subunit II × 1 （L8AFM8） Photosystem I reaction center subunit IV × 1 （L8ASH8） Photosystem I subunit III × 1 （L8AII8） Photosystem I reaction center subunit IX × 1 （L8AGL9） Photosystem I reaction center subunit PsaK × 1 （L8APJ0） PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 CHLOROPHYLL A ISOMER × 2 BETA-CAROTENE × 17 CHLOROPHYLL A × 90 DODECYL-ALPHA-D-MALTOSIDE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 CHLORIDE ION × 1 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	L8ADF9_9SYNC
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain M； PDBConstruct 1–31； UniProt 1–31

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4kt0
Deposition date deposition_date	2013-05-19
Structure title title	Crystal structure of a virus like photosystem I from the cyanobacterium Synechocystis PCC 6803
Keywords keywords	photosynthetic reaction center, membrane complex, plastocyanin, cytochrome C6, Ferredoxin, ELECTRON TRANSPORT; ELECTRON TRANSPORT
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4kt0__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4kt0__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4kt0__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	41.73 Å
Rg (electron density)	40.53 Å
Total Rg	41.02 Å
Atom count	22022
Residues	2017
Excluded volume	410350 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4kt0__assembly_1__model_1`	nonameric （9）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (19)

Entity 1 Entity 1 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	83036.4 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	22051

MTISPPEREAKAKVSVDNNPVPTSFEKWGKPGHFDRTLARGPKTTTWIWNLHANAHDFDSQTSDLEDVSRKIFSAHFGHLAVVFVWLSGMYFHGAKFSNYEGWLADPTHIKPSAQVVWPIVGQGILNGDVGGGFHGIQITSGLFYLWRASGFTDSYQLYCTAIGGLVMAALMLFAGWFHYHVKAPKLEWFQNVESMMNHHLAGLLGLGSLGWAGHQIHVSMPINKLLDAGVAPKDIPLPHEFILEPSKMAELYPSFAQGLTPFFTLNWGVYSDFLTFKGGLNPVTGGLWLSDTAHHHLAIAVLFIIAGHMYRTNWGIGHSMKEILEAHKGPFTGEGHKGLYEILTTSWHAQLAINLALLGSLTIIVAQHMYAMPPYPYQAIDYATQLSLFTHHMWIGGFLIVGAGAHGAIFMVRDYDPAKNVNNLLDRMLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMRALGRPQDMFSDTAIQLQPIFAQWVQHLHTLAPGATAPNALATASYAFGGETIAVAGKVAMMPITLGTADFMVHHIHAFTIHVTALILLKGVLYARSSRLVPDKANLGFRFPCDGPGRGGTCQVSGWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVSPDGSVTHVTLGNFAQSAITINGWLRDFLWAQAANVINSYGSALSAYGIMFLAGHFVFAFSLMFLFSGRGYWQELIESIVWAHNKLNVAPAIQPRALSIIQGRAVGVAHYLLGGIVTTWAFFLARSLSIG

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148

Entity 2 Entity 2 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	81369.5 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MATKFPKFSQDLAQDPTTRRIWYGIATAHDFETHDGMTEENLYQKIFASHFGHIAIIFLWTSGTLFHVAWQGNFEQWIKDPLNIRPIAHAIWDPHFGEGAVNAFTQAGASNPVNIAYSGVYHWFYTIGMTTNQELYSGAVFLLVLASLFLFAGWLHLQPKFRPSLAWFKNAESRLNHHLAGLFGVSSLAWAGHLVHVAIPEARGQHVGWDNFLSTPPHPAGLMPFFTGNWGVYAADPDTAGHIFGTSEGAGTAILTFLGGFHPQTESLWLTDIAHHHLAIAVIFIIAGHMYRTNWGIGHSIKEILNAHKGPLTGAGHTNLYDTINNSLHFQLGLALASLGVITSLVAQHMYSLPSYAFIAQDHTTQAALYTHHQYIAGFLMVGAFAHGAIFFVRDYDPVANKDNVLARMLEHKEALISHLSWVSLFLGFHTLGLYVHNDVVVAFGTPEKQILIEPVFAQWIQATSGKALYGFDVLLSNPDSIASTTGAAWLPGWLDAINSGTNSLFLTIGPGDFLVHHAIALGLHTTALILIKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFYLAMFWMLNTLGWLTFYWHWKHLGVWSGNVAQFNENSTYLMGWFRDYLWANSAQLINGYNPYGVNNLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETIVWAHERTPLANLVRWKDKPVALSIVQARLVGLAHFTVGYVLTYAAFLIASTAGKFG

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 3 Entity 3 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8837.3 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAAQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGLAY

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 4 Entity 4 polymer

Description description	Photosystem I subunit II
Molecular weight formula_weight	15663.7 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MTELSGQPPKFGGSTGGLLSKANREEKYAITWTSASEQVFEMPTGGAAIMNEGENLLYLARKEQCLALGTQLRTKFKPKIQDYKIYRVYPSGEVQYLHPADGVFPEKVNEGREAQGTKTRRIGQNPEPVTIKFSGKAPYEV

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 5 Entity 5 polymer

Description description	Photosystem I reaction center subunit IV
Molecular weight formula_weight	8154.1 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MALNRGDKVRIKRTESYWYGDVGTVASVEKSGILYPVIVRFDRVNYNGFSGSASGVNTNNFAENELELVQAAAK

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 6 Entity 6 polymer

Description description	Photosystem I subunit III
Molecular weight formula_weight	18267.1 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MKHLLALLLAFTLWFNFAPSASADDFANLTPCSENPAYLAKSKNFLNTTNDPNSGKIRAERYASALCGPEGYPHLIVDGRFTHAGDFLIPSILFLYIAGWIGWVGRSYLIEIRESKNPEMQEVVINVPLAIKKMLGGFLWPLAAVGEYTSGKLVMKDSEIPTSPR

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 7 Entity 7 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	4535.4 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MDGLKSFLSTAPVMIMALLTFTAGILIEFNRFYPDLLFHP

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 8 Entity 8 polymer

Description description	Photosystem I reaction center subunit PsaK
Molecular weight formula_weight	13732.3 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MTAIARERGRSKRGIALHRLEYLKENQVFEIIFGEPLSMFNTALLLAQASPTTAGWSLSVGIIMCLCNVFAFVIGYFAIQKTGKGKDLALPQLASKKTFGLPELLATMSFGHILGAGMVLGLASSGIL

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 9 Entity 9 polymer

Description description	Photosystem I reaction center subunit XII
Molecular weight formula_weight	3382.1 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MALSDTQILAALVVALLPAFLAFRLSTELYK

Source Source

Source organism organism	Synechocystis sp. PCC 6803
NCBI taxonomy ID ncbi_taxonomy_id	1148
Host organism host_organism	Synechocystis sp. PCC 6803

Entity 10 Entity 10 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 11 Entity 11 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 12 Entity 12 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 13 Entity 13 non-polymer

Description description	CHLOROPHYLL A ISOMER
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 14 Entity 14 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	17

Entity 15 Entity 15 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	90

Entity 16 Entity 16 non-polymer

Description description	DODECYL-ALPHA-D-MALTOSIDE
Molecular weight formula_weight	510.6 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 17 Entity 17 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 18 Entity 18 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 19 Entity 19 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	29

▼

6. Fold Classification (SCOP + CATH) 15 domains

SCOP 2.08 (7 domains)

Domain ID domain_id	d4kt0a_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.29 — Photosystem I subunits PsaA/PsaB
Superfamily Superfamily superfamily	f.29.1 — Photosystem I subunits PsaA/PsaB
Family Family family	f.29.1.1 — Photosystem I subunits PsaA/PsaB

Domain ID domain_id	d4kt0b_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.29 — Photosystem I subunits PsaA/PsaB
Superfamily Superfamily superfamily	f.29.1 — Photosystem I subunits PsaA/PsaB
Family Family family	f.29.1.1 — Photosystem I subunits PsaA/PsaB

Domain ID domain_id	d4kt0c_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.1 — 4Fe-4S ferredoxins
Family Family family	d.58.1.2 — 7-Fe ferredoxin

Domain ID domain_id	d4kt0d_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.187 — Photosystem I subunit PsaD
Superfamily Superfamily superfamily	d.187.1 — Photosystem I subunit PsaD
Family Family family	d.187.1.1 — Photosystem I subunit PsaD

Domain ID domain_id	d4kt0e_
Class class	b — All beta proteins
Fold Fold fold	b.34 — SH3-like barrel
Superfamily Superfamily superfamily	b.34.4 — Electron transport accessory proteins
Family Family family	b.34.4.2 — Photosystem I accessory protein E (PsaE)

Domain ID domain_id	d4kt0f_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.16 — Subunit III of photosystem I reaction centre, PsaF
Family Family family	f.23.16.1 — Subunit III of photosystem I reaction centre, PsaF

Domain ID domain_id	d4kt0j_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.18 — Subunit IX of photosystem I reaction centre, PsaJ
Family Family family	f.23.18.1 — Subunit IX of photosystem I reaction centre, PsaJ

CATH v4.4 (8 domains)

Domain ID domain_id	4kt0A00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1130 — Photosystem I p700 chlorophyll A apoprotein A1
Homologous superfamily homologous superfamily	10 — Photosystem I PsaA/PsaB

Domain ID domain_id	4kt0B00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1130 — Photosystem I p700 chlorophyll A apoprotein A1
Homologous superfamily homologous superfamily	10 — Photosystem I PsaA/PsaB

Domain ID domain_id	4kt0C00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	4kt0D00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1470 — Photosystem 1 Reaction Centre Subunit Ii; Chain: D;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaD, reaction center subunit II

Domain ID domain_id	4kt0E00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	50 —

Domain ID domain_id	4kt0F00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	8 — Helicase, Ruva Protein; domain 3
Homologous superfamily homologous superfamily	110 — Photosystem I, reaction centre, subunit PsaF

Domain ID domain_id	4kt0J00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	510 — Single helix bin

Domain ID domain_id	4kt0K00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	860 — Alpha-t-alpha
Homologous superfamily homologous superfamily	20 — Photosystem I PsaK, reaction centre

▶

Unit-cell length a length_a	120.179 Å
Unit-cell length b length_b	173.308 Å
Unit-cell length c length_c	179.136 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.800 Å
Low-resolution limit resolution_low	29.977 Å
R factor r_factor	0.2000
R_work r_work	0.1977
R_free r_free	0.2446

Crystal structure of a virus like photosystem I from the cyanobacterium Synechocystis PCC 6803

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I subunit II

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IV

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I subunit III

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit PsaK

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit XII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4kt0__assembly_1__model_1

4kt0__assembly_1__model_1 | I(q)

4kt0__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment