4lw9

Crystal structure of Vibrio cholera major pseudopilin EpsG

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Type II secretion system protein G

Vibrio cholerae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	ZINC ION × 3 SODIUM ION × 2 CALCIUM ION × 1 CHLORIDE ION × 1 PLATINUM (II) ION × 1 SULFATE ION × 1 water × 1	Consistent with protein count
10	Protein monomer	Monomer	Protein 1	ZINC ION × 3 CALCIUM ION × 1 CHLORIDE ION × 1 PLATINUM (II) ION × 1 water × 1	Consistent with protein count
11	Protein monomer	Monomer	Protein 1	ZINC ION × 3 CALCIUM ION × 2 PLATINUM (II) ION × 1 SULFATE ION × 1 water × 1	Consistent with protein count
12	Protein monomer	Monomer	Protein 1	ZINC ION × 1 CALCIUM ION × 1 CHLORIDE ION × 2 PLATINUM (II) ION × 1 SULFATE ION × 1 water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	ZINC ION × 1 SODIUM ION × 3 CALCIUM ION × 1 CHLORIDE ION × 1 PLATINUM (II) ION × 1 SULFATE ION × 1 water × 1	Consistent with protein count
3	Protein monomer	Monomer	Protein 1	ZINC ION × 3 CALCIUM ION × 1 PLATINUM (II) ION × 1 SULFATE ION × 1 water × 1	Consistent with protein count
4	Protein monomer	Monomer	Protein 1	ZINC ION × 3 SODIUM ION × 1 CALCIUM ION × 1 CHLORIDE ION × 1 PLATINUM (II) ION × 1 SULFATE ION × 2 water × 1	Consistent with protein count
5	Protein monomer	Monomer	Protein 1	ZINC ION × 4 CALCIUM ION × 1 CHLORIDE ION × 2 PLATINUM (II) ION × 1 SULFATE ION × 1 water × 1	Consistent with protein count
6	Protein monomer	Monomer	Protein 1	ZINC ION × 2 CALCIUM ION × 2 PLATINUM (II) ION × 1 SULFATE ION × 1 water × 1	Consistent with protein count
7	Protein monomer	Monomer	Protein 1	ZINC ION × 3 CALCIUM ION × 1 PLATINUM (II) ION × 1 SULFATE ION × 2 water × 1	Consistent with protein count
8	Protein monomer	Monomer	Protein 1	ZINC ION × 2 CALCIUM ION × 1 PLATINUM (II) ION × 1 SULFATE ION × 1 water × 1	Consistent with protein count
9	Protein monomer	Monomer	Protein 1	ZINC ION × 4 CALCIUM ION × 1 CHLORIDE ION × 1 PLATINUM (II) ION × 1 SULFATE ION × 2 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GSPG_VIBCH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–112； UniProt 35–146 Author chain B； PDBConstruct 1–112； UniProt 35–146 Author chain C； PDBConstruct 1–112； UniProt 35–146 Author chain D； PDBConstruct 1–112； UniProt 35–146 Author chain E； PDBConstruct 1–112； UniProt 35–146 Author chain F； PDBConstruct 1–112； UniProt 35–146 Author chain I； PDBConstruct 1–112； UniProt 35–146 Author chain J； PDBConstruct 1–112； UniProt 35–146 Author chain K； PDBConstruct 1–112； UniProt 35–146 Author chain L； PDBConstruct 1–112； UniProt 35–146 Author chain Q； PDBConstruct 1–112； UniProt 35–146 Author chain R； PDBConstruct 1–112； UniProt 35–146

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4lw9
Deposition date deposition_date	2013-07-26
Structure title title	Crystal structure of Vibrio cholera major pseudopilin EpsG
Keywords keywords	TYPE II SECRETION SYSTEM, PSEUDOPILUS, TRANSPORT PROTEIN; TRANSPORT PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4lw9__assembly_4__model_1

Assembly 4 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4lw9__assembly_4__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4lw9__assembly_4__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	16.33 Å
Rg (electron density)	15.00 Å
Total Rg	16.12 Å
Atom count	929
Residues	119
Excluded volume	16191 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4lw9__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4lw9__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`4lw9__assembly_3__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`4lw9__assembly_4__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`4lw9__assembly_5__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`4lw9__assembly_6__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
7	1	`4lw9__assembly_7__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
8	1	`4lw9__assembly_8__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
9	1	`4lw9__assembly_9__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
10	1	`4lw9__assembly_10__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
11	1	`4lw9__assembly_11__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
12	1	`4lw9__assembly_12__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Type II secretion system protein G
Molecular weight formula_weight	13391.5 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,I,J,K,L,Q,R
Atom count atom_count	11720

GNKEKADQQKAVTDIVALENALDMYKLDNSVYPTTDQGLEALVTKPTNPEPRNYREGGYIKRLPKDPWGNDYQYLSPGDKGTIDVFTLGADGQEGGEGTGADIGNWNIQDFQLEHHHHHH

Source Source

Source organism organism	Vibrio cholerae
NCBI taxonomy ID ncbi_taxonomy_id	243277
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	32

Entity 3 Entity 3 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 4 Entity 4 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	14

Entity 5 Entity 5 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 6 Entity 6 non-polymer

Description description	PLATINUM (II) ION
Molecular weight formula_weight	195.1 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 7 Entity 7 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	14

Entity 8 Entity 8 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	664

▼

6. Fold Classification (SCOP + CATH) 12 domains

CATH v4.4 (12 domains)

Domain ID domain_id	4lw9A01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	700 — Glycoprotein, Type 4 Pilin
Homologous superfamily homologous superfamily	10 — Glycoprotein, Type 4 Pilin

Domain ID domain_id	4lw9B01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	700 — Glycoprotein, Type 4 Pilin
Homologous superfamily homologous superfamily	10 — Glycoprotein, Type 4 Pilin

Domain ID domain_id	4lw9C01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	700 — Glycoprotein, Type 4 Pilin
Homologous superfamily homologous superfamily	10 — Glycoprotein, Type 4 Pilin

Domain ID domain_id	4lw9D01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	700 — Glycoprotein, Type 4 Pilin
Homologous superfamily homologous superfamily	10 — Glycoprotein, Type 4 Pilin

Domain ID domain_id	4lw9E01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	700 — Glycoprotein, Type 4 Pilin
Homologous superfamily homologous superfamily	10 — Glycoprotein, Type 4 Pilin

Domain ID domain_id	4lw9F01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	700 — Glycoprotein, Type 4 Pilin
Homologous superfamily homologous superfamily	10 — Glycoprotein, Type 4 Pilin

Domain ID domain_id	4lw9I01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	700 — Glycoprotein, Type 4 Pilin
Homologous superfamily homologous superfamily	10 — Glycoprotein, Type 4 Pilin

Domain ID domain_id	4lw9J01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	700 — Glycoprotein, Type 4 Pilin
Homologous superfamily homologous superfamily	10 — Glycoprotein, Type 4 Pilin

Domain ID domain_id	4lw9K01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	700 — Glycoprotein, Type 4 Pilin
Homologous superfamily homologous superfamily	10 — Glycoprotein, Type 4 Pilin

Domain ID domain_id	4lw9L01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	700 — Glycoprotein, Type 4 Pilin
Homologous superfamily homologous superfamily	10 — Glycoprotein, Type 4 Pilin

Domain ID domain_id	4lw9Q01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	700 — Glycoprotein, Type 4 Pilin
Homologous superfamily homologous superfamily	10 — Glycoprotein, Type 4 Pilin

Domain ID domain_id	4lw9R01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	700 — Glycoprotein, Type 4 Pilin
Homologous superfamily homologous superfamily	10 — Glycoprotein, Type 4 Pilin

▶

Unit-cell length a length_a	88.610 Å
Unit-cell length b length_b	70.015 Å
Unit-cell length c length_c	131.544 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	103.29 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.900 Å
Low-resolution limit resolution_low	29.540 Å
R factor r_factor	0.2047
R_work r_work	0.2025
R_free r_free	0.2453

Crystal structure of Vibrio cholera major pseudopilin EpsG

1. Protein Identity and Related Structures Protein Identity & Related Structures

Type II secretion system protein G

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4lw9__assembly_4__model_1

4lw9__assembly_4__model_1 | I(q)

4lw9__assembly_4__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

6. Fold Classification (SCOP + CATH) 12 domains

CATH v4.4 (12 domains)

7. Citations (1)

Crystal structure of Vibrio cholera major pseudopilin EpsG

1. Protein Identity and Related Structures Protein Identity & Related Structures

Type II secretion system protein G

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4lw9__assembly_4__model_1

4lw9__assembly_4__model_1 | I(q)

4lw9__assembly_4__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

6. Fold Classification (SCOP + CATH) 12 domains

CATH v4.4 (12 domains)

7. Citations (1)