SAXSdb — 4lx3

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA polymerase III, alpha subunit

Nostoc punctiforme

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Nucleic acid binding, OB-fold, tRNA/helicase-type × 1 （B2J821） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B2J066_NOSP7
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 7–108； UniProt 775–876

Nucleic acid binding, OB-fold, tRNA/helicase-type

Nostoc punctiforme

UniProt B2J821

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	DNA polymerase III, alpha subunit × 1 （B2J066） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B2J821_NOSP7
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–36； UniProt 1–36

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4lx3
Deposition date deposition_date	2013-07-29
Structure title title	Conserved Residues that Modulate Protein trans-Splicing of Npu DnaE Split Intein
Keywords keywords	trans-structure, naturally occurring, TRANSFERASE; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4lx3__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4lx3__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4lx3__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	15.38 Å
Rg (electron density)	14.12 Å
Total Rg	15.29 Å
Atom count	1114
Residues	133
Excluded volume	19822 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4lx3__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	DNA polymerase III, alpha subunit
Molecular weight formula_weight	12836.9 kDa
EC 编号 ec_number	2.7.7.7
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	1380

HHHHHHCLSYETEILTVEYGLLPIGKIVEKRIECTVYSVDNNGNIYTQPVAQWHDRGEQEVFEYCLEDGSLIRATKDHKFMTVDGQMLPIDEIFERELDLMRVDNLPN

Source Source

Source organism organism	Nostoc punctiforme
NCBI taxonomy ID ncbi_taxonomy_id	63737
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Nucleic acid binding, OB-fold, tRNA/helicase-type
Molecular weight formula_weight	4179.7 kDa
EC 编号 ec_number	2.7.7.7
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MIKIATRKYLGKQNVYDIGVERDHNFALKNGFIASN

Source Source

Source organism organism	Nostoc punctiforme
NCBI taxonomy ID ncbi_taxonomy_id	63737
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	215

▼

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	4lx3A00
Class class	2 — Mainly Beta
Architecture architecture	170 — Beta Complex
Topology topology	16 — Endonuclease - Pi-scei; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Hedgehog/Intein (Hint) domain

▶

Unit-cell length a length_a	44.029 Å
Unit-cell length b length_b	61.199 Å
Unit-cell length c length_c	103.997 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	—

Resolution resolution	1.500 Å
Low-resolution limit resolution_low	33.800 Å
R factor r_factor	0.1673
R_work r_work	0.1673
R_free r_free	0.1943

Conserved Residues that Modulate Protein trans-Splicing of Npu DnaE Split Intein

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA polymerase III, alpha subunit

State in the Current Structure

Other States of the Same Protein in the Database

Nucleic acid binding, OB-fold, tRNA/helicase-type

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4lx3__assembly_1__model_1

4lx3__assembly_1__model_1 | I(q)

4lx3__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

7. Citations (1)

Conserved Residues that Modulate Protein trans-Splicing of Npu DnaE Split Intein

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA polymerase III, alpha subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Nucleic acid binding, OB-fold, tRNA/helicase-type

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4lx3__assembly_1__model_1

4lx3__assembly_1__model_1 | I(q)

4lx3__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

7. Citations (1)