4o1q

Crystal Structure of the Q103N-MauG/pre-Methylamine Dehydrogenase Complex

Method: X-RAY DIFFRACTION D_max: 165.3 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Methylamine utilization protein MauG

Paracoccus denitrificans

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain A； UniProt 21–387 Chain B； UniProt 21–387	Fragment：UNP residues 21-387 Mutation：Q103N	Methylamine dehydrogenase light chain × 2 （A1BBA0） Methylamine dehydrogenase heavy chain × 2 （A1BB97） CA CALCIUM ION × 2 HEC HEME C × 4 EDO 1,2-ETHANEDIOL × 3 PO4 PHOSPHATE ION × 1 PGE TRIETHYLENE GLYCOL × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 2 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1 M MES, pH 6.4, 0.1 M sodium acetate, 24-30% w/v PEG8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.59 Å R-free 0.254

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4O1Q	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3L4M Crystal Structure of the MauG/pre-Methylamine Dehydrogenase Complex. Deposited 2009-12-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 21–387（367 aa） Chain B 21–387（367 aa）	Not recorded	CA CALCIUM ION × 2 HEC HEME C × 4 1PE PENTAETHYLENE GLYCOL × 1 PG4 TETRAETHYLENE GLYCOL × 1 ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 24-30 % w/v PEG 8000, vapor diffusion, hanging drop, temperature 293K	Resolution 2.02 Å R-free 0.189
3L4O Crystal Structure of the MauG/pre-Methylamine Dehydrogenase Complex After Treatment with Hydrogen Peroxide Deposited 2009-12-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 21–387（367 aa） Chain B 21–387（367 aa）	Not recorded	CA CALCIUM ION × 2 HEC HEME C × 4 1PE PENTAETHYLENE GLYCOL × 1 PG4 TETRAETHYLENE GLYCOL × 1 ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 24-30 % w/v PEG 8000; followed by reaction of the crystal with hydrogen peroxide immediately prior to flash cooling., VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.05 Å R-free 0.194
3ORV Crystal Structure of the Y294H-MauG/pre-Methylamine Dehydrogenase Complex Deposited 2010-09-07	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 21–387（367 aa） Fragment：UNP residues 21-387 Chain B 21–387（367 aa） Fragment：UNP residues 21-387	Mutation：Y294H Mutation：Y294H	CA CALCIUM ION × 2 HEC HEME C × 4 EDO 1,2-ETHANEDIOL × 3 PGE TRIETHYLENE GLYCOL × 1 PEG DI(HYDROXYETHYL)ETHER × 3 PG4 TETRAETHYLENE GLYCOL × 2 P6G HEXAETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.4；293 K；Drops contained 1uL protein with 2uL reservoir solution. Protein solution: 100uM Y294H-MauG and 50uM preMADH in 10mM potassium phosphate pH 7.5. Reservoir solution contained: 24-26 % w/v PEG 8000, 0.1 M sodium acetate, 0.1 M MES pH 6.4., VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.91 Å R-free 0.187
3PXS Crystal Structure of Diferrous MauG in Complex with Pre-Methylamine Dehydrogenase: Deposited 2010-12-10	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 21–387（367 aa） Fragment：UNP residues 21-387 Chain B 21–387（367 aa） Fragment：UNP residues 21-387	Not recorded	NA SODIUM ION × 4 HEC HEME C × 4 CA CALCIUM ION × 2 ACT ACETATE ION × 3 PG4 TETRAETHYLENE GLYCOL × 1 PG6 1-(2-METHOXY-ETHOXY)-2-{2-[2-(2-METHOXY-ETHOXY]-ETHOXY}-ETHANE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 23-25 % w/v PEG 8000, vapor diffusion, hanging drop, temperature 293K , VAPOR DIFFUSION, HANGING DROP	Resolution 2.22 Å R-free 0.229
3PXT Crystal Structure of Ferrous CO Adduct of MauG in Complex with Pre-Methylamine Dehydrogenase Deposited 2010-12-10	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 21–387（367 aa） Fragment：UNP residues 21-387 Chain B 21–387（367 aa） Fragment：UNP residues 21-387	Not recorded	NA SODIUM ION × 3 CMO CARBON MONOXIDE × 2 HEC HEME C × 4 CA CALCIUM ION × 2 ACT ACETATE ION × 3 PG6 1-(2-METHOXY-ETHOXY)-2-{2-[2-(2-METHOXY-ETHOXY]-ETHOXY}-ETHANE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 23-25 % w/v PEG 8000, vapor diffusion, hanging drop, temperature 293K, VAPOR DIFFUSION, HANGING DROP	Resolution 2.16 Å R-free 0.226
3PXW Crystal Structure of Ferrous NO Adduct of MauG in Complex with Pre-Methylamine Dehydrogenase Deposited 2010-12-10	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 21–387（367 aa） Fragment：UNP residues 21-387 Chain B 21–387（367 aa） Fragment：UNP residues 21-387	Not recorded	NA SODIUM ION × 2 NO NITRIC OXIDE × 2 HEC HEME C × 4 CA CALCIUM ION × 2 ACT ACETATE ION × 1 EDO 1,2-ETHANEDIOL × 1 PGE TRIETHYLENE GLYCOL × 1 PG6 1-(2-METHOXY-ETHOXY)-2-{2-[2-(2-METHOXY-ETHOXY]-ETHOXY}-ETHANE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 23-35 % w/v PEG 8000, vapor diffusion, hanging drop, temperature 293K, VAPOR DIFFUSION, HANGING DROP	Resolution 2.11 Å R-free 0.242
3RLM Structure of the W199F MauG/pre-Methylamine Dehydrogenase complex after treatment with hydrogen peroxide Deposited 2011-04-19	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 21–387（367 aa） Chain B 21–387（367 aa）	Mutation：W199F Mutation：W199F	CA CALCIUM ION × 2 HEC HEME C × 4 PGE TRIETHYLENE GLYCOL × 1 ACT ACETATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES, 0.1M sodium acetate, 23-25% w/v PEG 8000, pH 6.4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.13 Å R-free 0.237
3RMZ Crystal Structure of the W199F-MauG/pre-Methylamine Dehydrogenase Complex Deposited 2011-04-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 21–387（367 aa） Chain B 21–387（367 aa）	Mutation：W199F Mutation：W199F	CA CALCIUM ION × 2 NA SODIUM ION × 4 HEC HEME C × 4 EDO 1,2-ETHANEDIOL × 2 PEG DI(HYDROXYETHYL)ETHER × 1 ACT ACETATE ION × 1 PG4 TETRAETHYLENE GLYCOL × 1 P6G HEXAETHYLENE GLYCOL × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；Drops contained 1uL protein with 3uL reservoir solution. Protein solution: 100uM W199F-MauG and 50uM preMADH in 10mM potassium phosphate, pH 7.5. Reservoir solution contained: 22% w/v PEG 8000, 0.1M sodium acetate, 0.1M MES pH 6.4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.72 Å R-free 0.181
3RN0 Crystal Structure of the W199K-MauG/pre-Methylamine Dehydrogenase Complex Deposited 2011-04-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 21–387（367 aa） Chain B 21–387（367 aa）	Mutation：W199K Mutation：W199K	CA CALCIUM ION × 2 NA SODIUM ION × 4 HEC HEME C × 4 P6G HEXAETHYLENE GLYCOL × 1 PG4 TETRAETHYLENE GLYCOL × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；Drops contained 1uL protein with 2.5uL reservoir solution. Protein solution: 100uM W199K-MauG and 50uM preMADH in 10mM potassium phosphate, pH 7.5. Reservoir solution contained: 22% w/v PEG 8000, 0.1M sodium acetate, 0.1M MES pH 6.4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.91 Å R-free 0.230
3RN1 Crystal Structure of the W199E-MauG/pre-Methylamine Dehydrogenase Complex Deposited 2011-04-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 21–387（367 aa） Chain B 21–387（367 aa）	Mutation：W199E Mutation：W199E	CA CALCIUM ION × 2 NA SODIUM ION × 4 HEC HEME C × 4 EDO 1,2-ETHANEDIOL × 1 1PE PENTAETHYLENE GLYCOL × 1 PG4 TETRAETHYLENE GLYCOL × 1 ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；Drops contained 1uL protein with 3uL reservoir solution. Protein solution: 100uM W199E-MauG and 50uM preMADH in 10mM potassium phosphate pH, 7.5. Reservoir solution contained: 23% w/v PEG 8000, 0.1M sodium acetate, 0.1M MES pH 6.4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.93 Å R-free 0.192
3SJL Crystal Structure of the P107S-MauG/pre-Methylamine Dehydrogenase Complex Deposited 2011-06-21	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 21–387（367 aa） Fragment：UNP residues 21-387 Chain B 21–387（367 aa） Fragment：UNP residues 21-387	Mutation：P107S Mutation：P107S	CA CALCIUM ION × 2 NA SODIUM ION × 4 HEC HEME C × 4 PEG DI(HYDROXYETHYL)ETHER × 3 EDO 1,2-ETHANEDIOL × 3 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；Drops contained 1uL protein with 3uL reservoir solution. Protein solution: 100uM P107S-MauG and 50uM preMADH in 10mM potassium phosphate pH 7.5. Reservoir solution contained: 22% w/v PEG 8000, 0.1M sodium acetate, 0.1M MES pH 6.4., VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.63 Å R-free 0.180
3SLE Crystal Structure of the P107C-MauG/pre-Methylamine Dehydrogenase Complex Deposited 2011-06-24	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 21–387（367 aa） Fragment：UNP residues 21-387 Chain B 21–387（367 aa） Fragment：UNP residues 21-387	Mutation：P107C Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：P107C Non-standard monomer：Yes (specific site not provided by mmCIF)	CA CALCIUM ION × 2 HEC HEME C × 4 ACT ACETATE ION × 4 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 24-30 % w/v PEG 8000, vapor diffusion, hanging drop, temperature 293K, VAPOR DIFFUSION, HANGING DROP	Resolution 2.52 Å R-free 0.243
3SVW Crystal Structure of the P107V-MauG/pre-Methylamine Dehydrogenase Complex Deposited 2011-07-12	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 21–387（367 aa） Fragment：UNP residues 21-387 Chain B 21–387（367 aa） Fragment：UNP residues 21-387	Mutation：P107V Mutation：P107V	CA CALCIUM ION × 2 NA SODIUM ION × 4 HEC HEME C × 4 PGE TRIETHYLENE GLYCOL × 1 PEG DI(HYDROXYETHYL)ETHER × 3 EDO 1,2-ETHANEDIOL × 3 ACT ACETATE ION × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；Drops contained 1uL protein with 3uL reservoir solution. Protein solution: 100uM P107V-MauG and 50uM preMADH in 10mM potassium phosphate pH 7.5. Reservoir solution contained: 23% w/v PEG 8000, 0.1M sodium acetate, 0.1M MES pH 6.4., VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.86 Å R-free 0.174
3SWS Crystal Structure of the Quinone Form of Methylamine Dehydrogenase in Complex with the Diferric Form of MauG Deposited 2011-07-14	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 21–387（367 aa） Fragment：UNP residues 21-387 Chain B 21–387（367 aa） Fragment：UNP residues 21-387	Not recorded	CA CALCIUM ION × 2 NA SODIUM ION × 4 HEC HEME C × 4 EDO 1,2-ETHANEDIOL × 3 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 ACT ACETATE ION × 1 1PE PENTAETHYLENE GLYCOL × 1 PG4 TETRAETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；293 K；Drops contained 1uL protein with 3uL reservoir solution. Protein solution: 100uM WT-MauG and 50uM MADH in 10mM potassium phosphate pH 7.5. Reservoir solution contained: 25% w/v PEG 8000, 0.1M sodium acetate, 0.1M MES pH 6.2., VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.86 Å R-free 0.178
3SXT Crystal Structure of the Quinol Form of Methylamine Dehydrogenase in Complex with the Diferrous Form of MauG Deposited 2011-07-15	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 21–387（367 aa） Fragment：UNP residues 21-387 Chain B 21–387（367 aa） Fragment：UNP residues 21-387	Not recorded	CA CALCIUM ION × 2 NA SODIUM ION × 4 HEC HEME C × 4 EDO 1,2-ETHANEDIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.4；293 K；Drops contained 1uL protein with 3uL reservoir solution. WT-MauG and MADH were each reduced in an anaerobic glove box prior to preparing the protein mixture for crystallization. Protein mixture: 100uM reduced WT-MauG and 50uM reduced MADH in 10mM potassium phosphate pH7.5 with 2mM sodium dithionite. Reservoir solution contained: 22% w/v PEG 8000, 0.1M sodium acetate, 0.1M MES pH 6.4 and 2mM sodium dithionite. Crystallization was carried out in an anaerobic glove box at ambient temperature., VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.81 Å R-free 0.187
4FA1 Crystal Structure of WT MauG in Complex with Pre-Methylamine Dehydrogenase Aged 130 Days. Deposited 2012-05-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 21–387（367 aa） Chain B 21–387（367 aa）	Not recorded	CA CALCIUM ION × 2 HEC HEME C × 4 NA SODIUM ION × 2 EDO 1,2-ETHANEDIOL × 2 ACT ACETATE ION × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 22-26 % w/v PEG 8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.18 Å R-free 0.227
4FA4 Crystal Structure of WT MauG in Complex with Pre-Methylamine Dehydrogenase Aged 10 Days Deposited 2012-05-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 21–387（367 aa） Fragment：unp residues 21-387 Chain B 21–387（367 aa） Fragment：unp residues 21-387	Not recorded	CA CALCIUM ION × 2 HEC HEME C × 4 PGE TRIETHYLENE GLYCOL × 1 EDO 1,2-ETHANEDIOL × 2 NA SODIUM ION × 3 PO4 PHOSPHATE ION × 1 ACT ACETATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 22-26 % w/v PEG 8000, vapor diffusion, hanging drop, temperature 293K , VAPOR DIFFUSION, HANGING DROP	Resolution 2.14 Å R-free 0.227
4FA5 Crystal Structure of WT MauG in Complex with Pre-Methylamine Dehydrogenase Aged 20 Days Deposited 2012-05-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 21–387（367 aa） Fragment：unp residues 21-387 Chain B 21–387（367 aa） Fragment：unp residues 21-387	Not recorded	CA CALCIUM ION × 2 HEC HEME C × 4 EDO 1,2-ETHANEDIOL × 3 NA SODIUM ION × 3 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 22-26 % w/v PEG 8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.94 Å R-free 0.204
4FA9 Crystal Structure of WT MauG in Complex with Pre-Methylamine Dehydrogenase Aged 30 Days Deposited 2012-05-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 21–387（367 aa） Fragment：unp residues 21-387 Chain B 21–387（367 aa） Fragment：unp residues 21-387	Not recorded	CA CALCIUM ION × 2 HEC HEME C × 4 ACT ACETATE ION × 5 NA SODIUM ION × 4 EDO 1,2-ETHANEDIOL × 1 PGE TRIETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 22-26 % w/v PEG 8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.09 Å R-free 0.214
4FAN Crystal Structure of WT MauG in Complex with Pre-Methylamine Dehydrogenase Aged 40 Days Deposited 2012-05-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 21–387（367 aa） Fragment：unp residues 21-387 Chain B 21–387（367 aa） Fragment：unp residues 21-387	Not recorded	CA CALCIUM ION × 2 HEC HEME C × 4 ACT ACETATE ION × 1 NA SODIUM ION × 2 EDO 1,2-ETHANEDIOL × 1 PGE TRIETHYLENE GLYCOL × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 22-26 % w/v PEG 8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.08 Å R-free 0.234
4FAV Crystal Structure of WT MauG in Complex with Pre-Methylamine Dehydrogenase Aged 50 Days Deposited 2012-05-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 21–387（367 aa） Fragment：unp residues 21-387 Chain B 21–387（367 aa） Fragment：unp residues 21-387	Not recorded	CA CALCIUM ION × 2 HEC HEME C × 4 NA SODIUM ION × 2 EDO 1,2-ETHANEDIOL × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 2 PGE TRIETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 22-26 % w/v PEG 8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.08 Å R-free 0.224
4FB1 Crystal Structure of WT MauG in Complex with Pre-Methylamine Dehydrogenase Aged 60 Days Deposited 2012-05-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 21–387（367 aa） Fragment：unp residues 21-387 Chain B 21–387（367 aa） Fragment：unp residues 21-387	Not recorded	CA CALCIUM ION × 2 HEC HEME C × 4 NA SODIUM ION × 3 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 22-26 % w/v PEG 8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.15 Å R-free 0.222
4K3I Crystal Structure of the Quinol Form of Methylamine Dehydrogenase in Complex with the Diferrous Form of MauG, C2 Space Group Deposited 2013-04-10	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 21–387（367 aa） Fragment：UNP residues 21-387 Chain B 21–387（367 aa） Fragment：UNP residues 21-387	Not recorded	CA CALCIUM ION × 2 HEC HEME C × 4 NA SODIUM ION × 4 EDO 1,2-ETHANEDIOL × 4 ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；Drops contained 1uL protein with 3uL reservoir solution. WT-MauG and MADH were each reduced in an anaerobic glove box prior to preparing the protein mixture for crystallization. Protein mixture: 100uM reduced WT-MauG and 50uM reduced MADH in 10mM potassium phosphate pH7.5 with 2mM sodium dithionite. Reservoir solution contained: 24% w/v PEG 8000, 0.1M sodium acetate, 0.1M MES pH 6.4 and 2mM sodium dithionite. Crystallization was carried out in an anaerobic glove box at ambient temperature., VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.00 Å R-free 0.190
4L1Q Crystal Structure of the E113Q-MauG/pre-Methylamine Dehydrogenase Complex Deposited 2013-06-03	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 21–387（367 aa） Chain B 21–387（367 aa）	Mutation：E113Q Mutation：E113Q	CA CALCIUM ION × 2 HEC HEME C × 4 EDO 1,2-ETHANEDIOL × 3 NA SODIUM ION × 3 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 24-30% w/v PEG 8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.92 Å R-free 0.207
4L3G Crystal Structure of the E113Q-MauG/pre-Methylamine Dehydrogenase Complex Aged 120 Days Deposited 2013-06-05	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 21–387（367 aa） Chain B 21–387（367 aa）	Mutation：E113Q Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：E113Q Non-standard monomer：Yes (specific site not provided by mmCIF)	CA CALCIUM ION × 2 HEC HEME C × 4 NA SODIUM ION × 4 ACT ACETATE ION × 2 PGE TRIETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 24-30% w/v PEG 8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.05 Å R-free 0.210
4L3H Crystal Structure of the E113Q-MauG/pre-Methylamine Dehydrogenase Complex After Treatment with Hydrogen Peroxide Deposited 2013-06-05	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 21–387（367 aa） Chain B 21–387（367 aa）	Mutation：E113Q Mutation：E113Q	CA CALCIUM ION × 2 HEC HEME C × 4 NA SODIUM ION × 4 EDO 1,2-ETHANEDIOL × 4 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 2 PGE TRIETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 24-30 % w/v PEG 8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.79 Å R-free 0.198
4Y5R Crystal Structure of a T67A MauG/pre-Methylamine Dehydrogenase Complex Deposited 2015-02-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 26–380（355 aa） Fragment：UNP RESIDUES 26-380 Chain B 26–380（355 aa） Fragment：UNP RESIDUES 26-380	Mutation：T67A Mutation：T67A	CA CALCIUM ION × 2 HEC HEME C × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；292 K；25-30% PEG 8000, 0,1 M sodium Acetate, 0.1 M MES pH 6.4	Resolution 2.80 Å R-free 0.256

27 other PDB entries and 27 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	MAUG_PARDP
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 7–373； UniProt 21–387 Author chain B； PDBConstruct 7–373； UniProt 21–387

Methylamine dehydrogenase light chain

Paracoccus denitrificans

UniProt A1BBA0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain C； UniProt 58–188 Chain E； UniProt 58–188	Fragment：UNP residues 58-188 Non-standard monomer：Yes (specific site not provided by mmCIF)	Methylamine utilization protein MauG × 2 （Q51658） Methylamine dehydrogenase heavy chain × 2 （A1BB97） CA CALCIUM ION × 2 HEC HEME C × 4 EDO 1,2-ETHANEDIOL × 3 PO4 PHOSPHATE ION × 1 PGE TRIETHYLENE GLYCOL × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 2 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1 M MES, pH 6.4, 0.1 M sodium acetate, 24-30% w/v PEG8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.59 Å R-free 0.254

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 4O1Q	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3RLM Structure of the W199F MauG/pre-Methylamine Dehydrogenase complex after treatment with hydrogen peroxide Deposited 2011-04-19	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 58–188（131 aa） Chain E 58–188（131 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	CA CALCIUM ION × 2 HEC HEME C × 4 PGE TRIETHYLENE GLYCOL × 1 ACT ACETATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES, 0.1M sodium acetate, 23-25% w/v PEG 8000, pH 6.4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.13 Å R-free 0.237
3RMZ Crystal Structure of the W199F-MauG/pre-Methylamine Dehydrogenase Complex Deposited 2011-04-21	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 58–188（131 aa） Chain E 58–188（131 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	CA CALCIUM ION × 2 NA SODIUM ION × 4 HEC HEME C × 4 EDO 1,2-ETHANEDIOL × 2 PEG DI(HYDROXYETHYL)ETHER × 1 ACT ACETATE ION × 1 PG4 TETRAETHYLENE GLYCOL × 1 P6G HEXAETHYLENE GLYCOL × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；Drops contained 1uL protein with 3uL reservoir solution. Protein solution: 100uM W199F-MauG and 50uM preMADH in 10mM potassium phosphate, pH 7.5. Reservoir solution contained: 22% w/v PEG 8000, 0.1M sodium acetate, 0.1M MES pH 6.4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.72 Å R-free 0.181
3RN0 Crystal Structure of the W199K-MauG/pre-Methylamine Dehydrogenase Complex Deposited 2011-04-21	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 58–188（131 aa） Chain E 58–188（131 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	CA CALCIUM ION × 2 NA SODIUM ION × 4 HEC HEME C × 4 P6G HEXAETHYLENE GLYCOL × 1 PG4 TETRAETHYLENE GLYCOL × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；Drops contained 1uL protein with 2.5uL reservoir solution. Protein solution: 100uM W199K-MauG and 50uM preMADH in 10mM potassium phosphate, pH 7.5. Reservoir solution contained: 22% w/v PEG 8000, 0.1M sodium acetate, 0.1M MES pH 6.4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.91 Å R-free 0.230
3RN1 Crystal Structure of the W199E-MauG/pre-Methylamine Dehydrogenase Complex Deposited 2011-04-21	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 58–188（131 aa） Chain E 58–188（131 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	CA CALCIUM ION × 2 NA SODIUM ION × 4 HEC HEME C × 4 EDO 1,2-ETHANEDIOL × 1 1PE PENTAETHYLENE GLYCOL × 1 PG4 TETRAETHYLENE GLYCOL × 1 ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；Drops contained 1uL protein with 3uL reservoir solution. Protein solution: 100uM W199E-MauG and 50uM preMADH in 10mM potassium phosphate pH, 7.5. Reservoir solution contained: 23% w/v PEG 8000, 0.1M sodium acetate, 0.1M MES pH 6.4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.93 Å R-free 0.192
4L1Q Crystal Structure of the E113Q-MauG/pre-Methylamine Dehydrogenase Complex Deposited 2013-06-03	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 58–188（131 aa） Fragment：UNP residues 58-188 Chain E 58–188（131 aa） Fragment：UNP residues 58-188	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	CA CALCIUM ION × 2 HEC HEME C × 4 EDO 1,2-ETHANEDIOL × 3 NA SODIUM ION × 3 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 24-30% w/v PEG 8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.92 Å R-free 0.207
4L3G Crystal Structure of the E113Q-MauG/pre-Methylamine Dehydrogenase Complex Aged 120 Days Deposited 2013-06-05	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 58–188（131 aa） Fragment：UNP residues 58-188 Chain E 58–188（131 aa） Fragment：UNP residues 58-188	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	CA CALCIUM ION × 2 HEC HEME C × 4 NA SODIUM ION × 4 ACT ACETATE ION × 2 PGE TRIETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 24-30% w/v PEG 8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.05 Å R-free 0.210
4L3H Crystal Structure of the E113Q-MauG/pre-Methylamine Dehydrogenase Complex After Treatment with Hydrogen Peroxide Deposited 2013-06-05	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 58–188（131 aa） Fragment：UNP residues 58-188 Chain E 58–188（131 aa） Fragment：UNP residues 58-188	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	CA CALCIUM ION × 2 HEC HEME C × 4 NA SODIUM ION × 4 EDO 1,2-ETHANEDIOL × 4 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 2 PGE TRIETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 24-30 % w/v PEG 8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.79 Å R-free 0.198

7 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A1BBA0_PARDP
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 7–137； UniProt 58–188 Author chain E； PDBConstruct 7–137； UniProt 58–188

Methylamine dehydrogenase heavy chain

Paracoccus denitrificans

UniProt A1BB97

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain D； UniProt 33–417 Chain F； UniProt 33–417	Fragment：UNP residues 33-417	Methylamine utilization protein MauG × 2 （Q51658） Methylamine dehydrogenase light chain × 2 （A1BBA0） CA CALCIUM ION × 2 HEC HEME C × 4 EDO 1,2-ETHANEDIOL × 3 PO4 PHOSPHATE ION × 1 PGE TRIETHYLENE GLYCOL × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 2 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1 M MES, pH 6.4, 0.1 M sodium acetate, 24-30% w/v PEG8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.59 Å R-free 0.254

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 4O1Q	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3L4M Crystal Structure of the MauG/pre-Methylamine Dehydrogenase Complex. Deposited 2009-12-21	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 32–417（386 aa） Chain F 32–417（386 aa）	Not recorded	CA CALCIUM ION × 2 HEC HEME C × 4 1PE PENTAETHYLENE GLYCOL × 1 PG4 TETRAETHYLENE GLYCOL × 1 ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 24-30 % w/v PEG 8000, vapor diffusion, hanging drop, temperature 293K	Resolution 2.02 Å R-free 0.189
3L4O Crystal Structure of the MauG/pre-Methylamine Dehydrogenase Complex After Treatment with Hydrogen Peroxide Deposited 2009-12-21	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 32–417（386 aa） Chain F 32–417（386 aa）	Not recorded	CA CALCIUM ION × 2 HEC HEME C × 4 1PE PENTAETHYLENE GLYCOL × 1 PG4 TETRAETHYLENE GLYCOL × 1 ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 24-30 % w/v PEG 8000; followed by reaction of the crystal with hydrogen peroxide immediately prior to flash cooling., VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.05 Å R-free 0.194
3ORV Crystal Structure of the Y294H-MauG/pre-Methylamine Dehydrogenase Complex Deposited 2010-09-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 32–417（386 aa） Fragment：UNP residues 32-417 Chain F 32–417（386 aa） Fragment：UNP residues 32-417	Not recorded	CA CALCIUM ION × 2 HEC HEME C × 4 EDO 1,2-ETHANEDIOL × 3 PGE TRIETHYLENE GLYCOL × 1 PEG DI(HYDROXYETHYL)ETHER × 3 PG4 TETRAETHYLENE GLYCOL × 2 P6G HEXAETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.4；293 K；Drops contained 1uL protein with 2uL reservoir solution. Protein solution: 100uM Y294H-MauG and 50uM preMADH in 10mM potassium phosphate pH 7.5. Reservoir solution contained: 24-26 % w/v PEG 8000, 0.1 M sodium acetate, 0.1 M MES pH 6.4., VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.91 Å R-free 0.187
3PXS Crystal Structure of Diferrous MauG in Complex with Pre-Methylamine Dehydrogenase: Deposited 2010-12-10	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 32–417（386 aa） Fragment：UNP residues 32-417 Chain F 32–417（386 aa） Fragment：UNP residues 32-417	Not recorded	NA SODIUM ION × 4 HEC HEME C × 4 CA CALCIUM ION × 2 ACT ACETATE ION × 3 PG4 TETRAETHYLENE GLYCOL × 1 PG6 1-(2-METHOXY-ETHOXY)-2-{2-[2-(2-METHOXY-ETHOXY]-ETHOXY}-ETHANE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 23-25 % w/v PEG 8000, vapor diffusion, hanging drop, temperature 293K , VAPOR DIFFUSION, HANGING DROP	Resolution 2.22 Å R-free 0.229
3PXT Crystal Structure of Ferrous CO Adduct of MauG in Complex with Pre-Methylamine Dehydrogenase Deposited 2010-12-10	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 32–417（386 aa） Fragment：UNP residues 32-417 Chain F 32–417（386 aa） Fragment：UNP residues 32-417	Not recorded	NA SODIUM ION × 3 CMO CARBON MONOXIDE × 2 HEC HEME C × 4 CA CALCIUM ION × 2 ACT ACETATE ION × 3 PG6 1-(2-METHOXY-ETHOXY)-2-{2-[2-(2-METHOXY-ETHOXY]-ETHOXY}-ETHANE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 23-25 % w/v PEG 8000, vapor diffusion, hanging drop, temperature 293K, VAPOR DIFFUSION, HANGING DROP	Resolution 2.16 Å R-free 0.226
3PXW Crystal Structure of Ferrous NO Adduct of MauG in Complex with Pre-Methylamine Dehydrogenase Deposited 2010-12-10	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 33–417（385 aa） Fragment：UNP residues 32-417 Chain F 33–417（385 aa） Fragment：UNP residues 32-417	Not recorded	NA SODIUM ION × 2 NO NITRIC OXIDE × 2 HEC HEME C × 4 CA CALCIUM ION × 2 ACT ACETATE ION × 1 EDO 1,2-ETHANEDIOL × 1 PGE TRIETHYLENE GLYCOL × 1 PG6 1-(2-METHOXY-ETHOXY)-2-{2-[2-(2-METHOXY-ETHOXY]-ETHOXY}-ETHANE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 23-35 % w/v PEG 8000, vapor diffusion, hanging drop, temperature 293K, VAPOR DIFFUSION, HANGING DROP	Resolution 2.11 Å R-free 0.242
3RLM Structure of the W199F MauG/pre-Methylamine Dehydrogenase complex after treatment with hydrogen peroxide Deposited 2011-04-19	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 32–417（386 aa） Chain F 32–417（386 aa）	Not recorded	CA CALCIUM ION × 2 HEC HEME C × 4 PGE TRIETHYLENE GLYCOL × 1 ACT ACETATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES, 0.1M sodium acetate, 23-25% w/v PEG 8000, pH 6.4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.13 Å R-free 0.237
3RMZ Crystal Structure of the W199F-MauG/pre-Methylamine Dehydrogenase Complex Deposited 2011-04-21	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 32–417（386 aa） Chain F 32–417（386 aa）	Not recorded	CA CALCIUM ION × 2 NA SODIUM ION × 4 HEC HEME C × 4 EDO 1,2-ETHANEDIOL × 2 PEG DI(HYDROXYETHYL)ETHER × 1 ACT ACETATE ION × 1 PG4 TETRAETHYLENE GLYCOL × 1 P6G HEXAETHYLENE GLYCOL × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；Drops contained 1uL protein with 3uL reservoir solution. Protein solution: 100uM W199F-MauG and 50uM preMADH in 10mM potassium phosphate, pH 7.5. Reservoir solution contained: 22% w/v PEG 8000, 0.1M sodium acetate, 0.1M MES pH 6.4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.72 Å R-free 0.181
3RN0 Crystal Structure of the W199K-MauG/pre-Methylamine Dehydrogenase Complex Deposited 2011-04-21	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 32–417（386 aa） Chain F 32–417（386 aa）	Not recorded	CA CALCIUM ION × 2 NA SODIUM ION × 4 HEC HEME C × 4 P6G HEXAETHYLENE GLYCOL × 1 PG4 TETRAETHYLENE GLYCOL × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；Drops contained 1uL protein with 2.5uL reservoir solution. Protein solution: 100uM W199K-MauG and 50uM preMADH in 10mM potassium phosphate, pH 7.5. Reservoir solution contained: 22% w/v PEG 8000, 0.1M sodium acetate, 0.1M MES pH 6.4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.91 Å R-free 0.230
3RN1 Crystal Structure of the W199E-MauG/pre-Methylamine Dehydrogenase Complex Deposited 2011-04-21	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 32–417（386 aa） Chain F 32–417（386 aa）	Not recorded	CA CALCIUM ION × 2 NA SODIUM ION × 4 HEC HEME C × 4 EDO 1,2-ETHANEDIOL × 1 1PE PENTAETHYLENE GLYCOL × 1 PG4 TETRAETHYLENE GLYCOL × 1 ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；Drops contained 1uL protein with 3uL reservoir solution. Protein solution: 100uM W199E-MauG and 50uM preMADH in 10mM potassium phosphate pH, 7.5. Reservoir solution contained: 23% w/v PEG 8000, 0.1M sodium acetate, 0.1M MES pH 6.4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.93 Å R-free 0.192
3SJL Crystal Structure of the P107S-MauG/pre-Methylamine Dehydrogenase Complex Deposited 2011-06-21	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 32–417（386 aa） Fragment：UNP residues 32-417 Chain F 32–417（386 aa） Fragment：UNP residues 32-417	Not recorded	CA CALCIUM ION × 2 NA SODIUM ION × 4 HEC HEME C × 4 PEG DI(HYDROXYETHYL)ETHER × 3 EDO 1,2-ETHANEDIOL × 3 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；Drops contained 1uL protein with 3uL reservoir solution. Protein solution: 100uM P107S-MauG and 50uM preMADH in 10mM potassium phosphate pH 7.5. Reservoir solution contained: 22% w/v PEG 8000, 0.1M sodium acetate, 0.1M MES pH 6.4., VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.63 Å R-free 0.180
3SLE Crystal Structure of the P107C-MauG/pre-Methylamine Dehydrogenase Complex Deposited 2011-06-24	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 33–417（385 aa） Fragment：UNP residues 32-417 Chain F 33–417（385 aa） Fragment：UNP residues 32-417	Not recorded	CA CALCIUM ION × 2 HEC HEME C × 4 ACT ACETATE ION × 4 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 24-30 % w/v PEG 8000, vapor diffusion, hanging drop, temperature 293K, VAPOR DIFFUSION, HANGING DROP	Resolution 2.52 Å R-free 0.243
3SVW Crystal Structure of the P107V-MauG/pre-Methylamine Dehydrogenase Complex Deposited 2011-07-12	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 32–417（386 aa） Fragment：UNP residues 32-417 Chain F 32–417（386 aa） Fragment：UNP residues 32-417	Not recorded	CA CALCIUM ION × 2 NA SODIUM ION × 4 HEC HEME C × 4 PGE TRIETHYLENE GLYCOL × 1 PEG DI(HYDROXYETHYL)ETHER × 3 EDO 1,2-ETHANEDIOL × 3 ACT ACETATE ION × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；Drops contained 1uL protein with 3uL reservoir solution. Protein solution: 100uM P107V-MauG and 50uM preMADH in 10mM potassium phosphate pH 7.5. Reservoir solution contained: 23% w/v PEG 8000, 0.1M sodium acetate, 0.1M MES pH 6.4., VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.86 Å R-free 0.174
3SWS Crystal Structure of the Quinone Form of Methylamine Dehydrogenase in Complex with the Diferric Form of MauG Deposited 2011-07-14	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 32–417（386 aa） Fragment：UNP residues 32-417 Chain F 32–417（386 aa） Fragment：UNP residues 32-417	Not recorded	CA CALCIUM ION × 2 NA SODIUM ION × 4 HEC HEME C × 4 EDO 1,2-ETHANEDIOL × 3 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 ACT ACETATE ION × 1 1PE PENTAETHYLENE GLYCOL × 1 PG4 TETRAETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；293 K；Drops contained 1uL protein with 3uL reservoir solution. Protein solution: 100uM WT-MauG and 50uM MADH in 10mM potassium phosphate pH 7.5. Reservoir solution contained: 25% w/v PEG 8000, 0.1M sodium acetate, 0.1M MES pH 6.2., VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.86 Å R-free 0.178
3SXT Crystal Structure of the Quinol Form of Methylamine Dehydrogenase in Complex with the Diferrous Form of MauG Deposited 2011-07-15	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 32–417（386 aa） Fragment：UNP residues 32-417 Chain F 32–417（386 aa） Fragment：UNP residues 32-417	Not recorded	CA CALCIUM ION × 2 NA SODIUM ION × 4 HEC HEME C × 4 EDO 1,2-ETHANEDIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.4；293 K；Drops contained 1uL protein with 3uL reservoir solution. WT-MauG and MADH were each reduced in an anaerobic glove box prior to preparing the protein mixture for crystallization. Protein mixture: 100uM reduced WT-MauG and 50uM reduced MADH in 10mM potassium phosphate pH7.5 with 2mM sodium dithionite. Reservoir solution contained: 22% w/v PEG 8000, 0.1M sodium acetate, 0.1M MES pH 6.4 and 2mM sodium dithionite. Crystallization was carried out in an anaerobic glove box at ambient temperature., VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.81 Å R-free 0.187
4FA1 Crystal Structure of WT MauG in Complex with Pre-Methylamine Dehydrogenase Aged 130 Days. Deposited 2012-05-21	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 33–417（385 aa） Chain F 33–417（385 aa）	Not recorded	CA CALCIUM ION × 2 HEC HEME C × 4 NA SODIUM ION × 2 EDO 1,2-ETHANEDIOL × 2 ACT ACETATE ION × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 22-26 % w/v PEG 8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.18 Å R-free 0.227
4FA4 Crystal Structure of WT MauG in Complex with Pre-Methylamine Dehydrogenase Aged 10 Days Deposited 2012-05-21	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 33–417（385 aa） Fragment：unp residues 33-417 Chain F 33–417（385 aa） Fragment：unp residues 33-417	Not recorded	CA CALCIUM ION × 2 HEC HEME C × 4 PGE TRIETHYLENE GLYCOL × 1 EDO 1,2-ETHANEDIOL × 2 NA SODIUM ION × 3 PO4 PHOSPHATE ION × 1 ACT ACETATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 22-26 % w/v PEG 8000, vapor diffusion, hanging drop, temperature 293K , VAPOR DIFFUSION, HANGING DROP	Resolution 2.14 Å R-free 0.227
4FA5 Crystal Structure of WT MauG in Complex with Pre-Methylamine Dehydrogenase Aged 20 Days Deposited 2012-05-21	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 33–417（385 aa） Fragment：unp residues 33-417 Chain F 33–417（385 aa） Fragment：unp residues 33-417	Not recorded	CA CALCIUM ION × 2 HEC HEME C × 4 EDO 1,2-ETHANEDIOL × 3 NA SODIUM ION × 3 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 22-26 % w/v PEG 8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.94 Å R-free 0.204
4FA9 Crystal Structure of WT MauG in Complex with Pre-Methylamine Dehydrogenase Aged 30 Days Deposited 2012-05-21	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 33–417（385 aa） Fragment：unp residues 33-417 Chain F 33–417（385 aa） Fragment：unp residues 33-417	Not recorded	CA CALCIUM ION × 2 HEC HEME C × 4 ACT ACETATE ION × 5 NA SODIUM ION × 4 EDO 1,2-ETHANEDIOL × 1 PGE TRIETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 22-26 % w/v PEG 8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.09 Å R-free 0.214
4FAN Crystal Structure of WT MauG in Complex with Pre-Methylamine Dehydrogenase Aged 40 Days Deposited 2012-05-22	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 33–417（385 aa） Fragment：unp residues 33-417 Chain F 33–417（385 aa） Fragment：unp residues 33-417	Not recorded	CA CALCIUM ION × 2 HEC HEME C × 4 ACT ACETATE ION × 1 NA SODIUM ION × 2 EDO 1,2-ETHANEDIOL × 1 PGE TRIETHYLENE GLYCOL × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 22-26 % w/v PEG 8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.08 Å R-free 0.234
4FAV Crystal Structure of WT MauG in Complex with Pre-Methylamine Dehydrogenase Aged 50 Days Deposited 2012-05-22	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 33–417（385 aa） Fragment：unp residues 33-417 Chain F 33–417（385 aa） Fragment：unp residues 33-417	Not recorded	CA CALCIUM ION × 2 HEC HEME C × 4 NA SODIUM ION × 2 EDO 1,2-ETHANEDIOL × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 2 PGE TRIETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 22-26 % w/v PEG 8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.08 Å R-free 0.224
4FB1 Crystal Structure of WT MauG in Complex with Pre-Methylamine Dehydrogenase Aged 60 Days Deposited 2012-05-22	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 33–417（385 aa） Fragment：unp residues 33-417 Chain F 33–417（385 aa） Fragment：unp residues 33-417	Not recorded	CA CALCIUM ION × 2 HEC HEME C × 4 NA SODIUM ION × 3 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 22-26 % w/v PEG 8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.15 Å R-free 0.222
4K3I Crystal Structure of the Quinol Form of Methylamine Dehydrogenase in Complex with the Diferrous Form of MauG, C2 Space Group Deposited 2013-04-10	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 33–417（385 aa） Fragment：UNP residues 33-417 Chain F 33–417（385 aa） Fragment：UNP residues 33-417	Not recorded	CA CALCIUM ION × 2 HEC HEME C × 4 NA SODIUM ION × 4 EDO 1,2-ETHANEDIOL × 4 ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；Drops contained 1uL protein with 3uL reservoir solution. WT-MauG and MADH were each reduced in an anaerobic glove box prior to preparing the protein mixture for crystallization. Protein mixture: 100uM reduced WT-MauG and 50uM reduced MADH in 10mM potassium phosphate pH7.5 with 2mM sodium dithionite. Reservoir solution contained: 24% w/v PEG 8000, 0.1M sodium acetate, 0.1M MES pH 6.4 and 2mM sodium dithionite. Crystallization was carried out in an anaerobic glove box at ambient temperature., VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.00 Å R-free 0.190
4L1Q Crystal Structure of the E113Q-MauG/pre-Methylamine Dehydrogenase Complex Deposited 2013-06-03	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 33–417（385 aa） Chain F 33–417（385 aa）	Not recorded	CA CALCIUM ION × 2 HEC HEME C × 4 EDO 1,2-ETHANEDIOL × 3 NA SODIUM ION × 3 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 24-30% w/v PEG 8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.92 Å R-free 0.207
4L3G Crystal Structure of the E113Q-MauG/pre-Methylamine Dehydrogenase Complex Aged 120 Days Deposited 2013-06-05	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 33–417（385 aa） Chain F 33–417（385 aa）	Not recorded	CA CALCIUM ION × 2 HEC HEME C × 4 NA SODIUM ION × 4 ACT ACETATE ION × 2 PGE TRIETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 24-30% w/v PEG 8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.05 Å R-free 0.210
4L3H Crystal Structure of the E113Q-MauG/pre-Methylamine Dehydrogenase Complex After Treatment with Hydrogen Peroxide Deposited 2013-06-05	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 33–417（385 aa） Chain F 33–417（385 aa）	Not recorded	CA CALCIUM ION × 2 HEC HEME C × 4 NA SODIUM ION × 4 EDO 1,2-ETHANEDIOL × 4 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 2 PGE TRIETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；293 K；0.1M MES pH 6.4, 0.1M sodium acetate, 24-30 % w/v PEG 8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.79 Å R-free 0.198
4Y5R Crystal Structure of a T67A MauG/pre-Methylamine Dehydrogenase Complex Deposited 2015-02-11	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 42–417（376 aa） Fragment：UNP RESIDUES 42-417 Chain F 42–417（376 aa） Fragment：UNP RESIDUES 42-417	Not recorded	CA CALCIUM ION × 2 HEC HEME C × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.4；292 K；25-30% PEG 8000, 0,1 M sodium Acetate, 0.1 M MES pH 6.4	Resolution 2.80 Å R-free 0.256

27 other PDB entries and 27 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A1BB97_PARDP
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–385； UniProt 33–417 Author chain F； PDBConstruct 1–385； UniProt 33–417

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4o1q
Deposition date deposition_date	2013-12-16
Structure title title	Crystal Structure of the Q103N-MauG/pre-Methylamine Dehydrogenase Complex
Keywords keywords	OXIDOREDUCTASE; OXIDOREDUCTASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	42.51 Å
Radius of gyration Rg (electron density) rg_electron	42.63 Å
Forward intensity I(0) i0	1087740000.00
Molecular weight molecular_weight	178210.0 kDa
Excluded volume excluded_volume	171090 Å³
Envelope volume envelope_volume	292800 Å³
Hydration-shell volume shell_volume	59959 Å³
Envelope diameter envelope_diameter	173.7 Å
Shell Rg shell_rg	44.89 Å
Envelope Rg envelope_rg	42.92 Å
Shape Rg shape_rg	42.62 Å
Total Rg total_rg	42.74 Å
Total atoms total_atoms	13457
Residues n_residues	1709
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	165.3 Å
Rg (real space) rg_real	42.89 Å
Rg uncertainty (real space) rg_real_error	1.84 Å
I(0) (real space) i0_real	1.0880e+09
I(0) uncertainty (real space) i0_real_error	2.0050e+07
Rg (reciprocal space) rg_reciprocal	42.51 Å
I(0) (reciprocal space) i0_reciprocal	1087000000.0000
Solution quality estimate total_estimate	0.7893
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	40.2 Å
Skewness Skewness skewness	0.646
Kurtosis Kurtosis kurtosis	0.181
Angular range angular_range	— – 0.1850 Å⁻¹
Current regularization parameter α current_alpha	0.0002
Highest regularization parameter α highest_alpha	101800000.0000
Real-space data points n_real_points	38
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.530; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.714; Smooth: 0.953

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (11)

Entity 1 Entity 1 polymer

Description description	Methylamine utilization protein MauG
Molecular weight formula_weight	41132.6 kDa
EC 编号 ec_number	1.-.-.-
Mutation mutation	Q103N
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	13884

HHHHHHEQARPADDALAALGAQLFVDPALSRNATQSCATCHDPARAFTDPREGKAGLAVSVGDDGQSHGDRNTPTLGYAALVPAFHRDANGKYKGGQFWDGRADDLKQNAGQPMLNPVEMAMPDRAAVAARLRDDPAYRTGFEALFGKGVLDDPERAFDAAAEALAAYQATGEFSPFDSKYDRVMRGEEKFTPLEEFGYTVFITWNCRLCHMQRKQGVAERETFTNFEYHNIGLPVNETAREASGLGADHVDHGLLARPGIEDPAQSGRFKVPSLRNVAVTGPYMHNGVFTDLRTAILFYNKYTSRRPEAKINPETGAPWGEPEVARNLSLAELQSGLMLDDGRVDALVAFLETLTDRRYEPLLEESRAAQKD

来源 Source

来源生物 organism	Paracoccus denitrificans
NCBI Class编号 ncbi_taxonomy_id	318586
宿主生物 host_organism	Paracoccus denitrificans

Entity 2 Entity 2 polymer

Description description	Methylamine dehydrogenase light chain
Molecular weight formula_weight	15025.6 kDa
EC 编号 ec_number	1.4.99.3
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,E

HHHHHHADAPAGTDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASWVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS

来源 Source

来源生物 organism	Paracoccus denitrificans
NCBI Class编号 ncbi_taxonomy_id	318586
宿主生物 host_organism	Rhodobacter sphaeroides

Entity 3 Entity 3 polymer

Description description	Methylamine dehydrogenase heavy chain
Molecular weight formula_weight	42321.2 kDa
EC 编号 ec_number	1.4.99.3
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,F

DAPEAETQAQETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG

来源 Source

来源生物 organism	Paracoccus denitrificans
NCBI Class编号 ncbi_taxonomy_id	318586
宿主生物 host_organism	Rhodobacter sphaeroides

Entity 4 Entity 4 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 5 Entity 5 non-polymer

Description description	HEME C
Molecular weight formula_weight	618.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 6 Entity 6 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 7 Entity 7 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 8 Entity 8 non-polymer

Description description	TRIETHYLENE GLYCOL
Molecular weight formula_weight	150.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 9 Entity 9 non-polymer

Description description	2-(N-MORPHOLINO)-ETHANESULFONIC ACID
Molecular weight formula_weight	195.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 10 Entity 10 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 11 Entity 11 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	397

▼

7. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d4o1qc_
Class class	g — Small proteins
Fold Fold fold	g.21 — Methylamine dehydrogenase, L chain
Superfamily Superfamily superfamily	g.21.1 — Methylamine dehydrogenase, L chain
Family Family family	g.21.1.1 — Methylamine dehydrogenase, L chain

Domain ID domain_id	d4o1qe_
Class class	g — Small proteins
Fold Fold fold	g.21 — Methylamine dehydrogenase, L chain
Superfamily Superfamily superfamily	g.21.1 — Methylamine dehydrogenase, L chain
Family Family family	g.21.1.1 — Methylamine dehydrogenase, L chain

CATH v4.4 (8 domains)

Domain ID domain_id	4o1qA01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	760 — Cytochrome Bc1 Complex; Chain D, domain 2
Homologous superfamily homologous superfamily	10 — Cytochrome c-like domain

Domain ID domain_id	4o1qA02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	760 — Cytochrome Bc1 Complex; Chain D, domain 2
Homologous superfamily homologous superfamily	10 — Cytochrome c-like domain

Domain ID domain_id	4o1qB01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	760 — Cytochrome Bc1 Complex; Chain D, domain 2
Homologous superfamily homologous superfamily	10 — Cytochrome c-like domain

Domain ID domain_id	4o1qB02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	760 — Cytochrome Bc1 Complex; Chain D, domain 2
Homologous superfamily homologous superfamily	10 — Cytochrome c-like domain

Domain ID domain_id	4o1qC00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	30 — Electron Transport Ethylamine Dehydrogenase
Homologous superfamily homologous superfamily	10 — Methylamine/Aralkylamine dehydrogenase light chain

Domain ID domain_id	4o1qD00
Class class	2 — Mainly Beta
Architecture architecture	130 — 7 Propeller
Topology topology	10 — Methylamine Dehydrogenase; Chain H
Homologous superfamily homologous superfamily	10 — YVTN repeat-like/Quinoprotein amine dehydrogenase

Domain ID domain_id	4o1qE00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	30 — Electron Transport Ethylamine Dehydrogenase
Homologous superfamily homologous superfamily	10 — Methylamine/Aralkylamine dehydrogenase light chain

Domain ID domain_id	4o1qF00
Class class	2 — Mainly Beta
Architecture architecture	130 — 7 Propeller
Topology topology	10 — Methylamine Dehydrogenase; Chain H
Homologous superfamily homologous superfamily	10 — YVTN repeat-like/Quinoprotein amine dehydrogenase

▶

8. Citations (1)

▶

Unit-cell length a length_a	55.530 Å
Unit-cell length b length_b	83.520 Å
Unit-cell length c length_c	107.780 Å
Unit-cell angle α angle_alpha	109.94 °
Unit-cell angle β angle_beta	91.54 °
Unit-cell angle γ angle_gamma	105.78 °
Molecules per unit cell Z z_pdb	2

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.590 Å
Low-resolution limit resolution_low	44.490 Å
R factor r_factor	0.2007
R_work r_work	0.1978
R_free r_free	0.2542

fit	/app/data/saxs_computation/o1/4o1q/4o1q.fit
pddf	/app/data/pr_computation/o1/4o1q/4o1q.pr.out
profile	/app/data/saxs_computation/o1/4o1q/4o1q.dat

Crystal Structure of the Q103N-MauG/pre-Methylamine Dehydrogenase Complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Methylamine utilization protein MauG

State in the Current Structure

Other States of the Same Protein in the Database

Methylamine dehydrogenase light chain

State in the Current Structure

Other States of the Same Protein in the Database

Methylamine dehydrogenase heavy chain

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (11)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

Entity 9 Entity 9 non-polymer

Entity 10 Entity 10 non-polymer

Entity 11 Entity 11 water

7. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (2 domains)

CATH v4.4 (8 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)