4pj1

Crystal structure of the human mitochondrial chaperonin symmetrical 'football' complex

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

60 kDa heat shock protein, mitochondrial

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	10 kDa heat shock protein, mitochondrial × 14 （P61604） ADENOSINE-5'-DIPHOSPHATE × 14 MAGNESIUM ION × 14	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CH60_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 29–558； UniProt 27–556 Author chain B； PDBConstruct 29–558； UniProt 27–556 Author chain C； PDBConstruct 29–558； UniProt 27–556 Author chain D； PDBConstruct 29–558； UniProt 27–556 Author chain E； PDBConstruct 29–558； UniProt 27–556 Author chain F； PDBConstruct 29–558； UniProt 27–556 Author chain G； PDBConstruct 29–558； UniProt 27–556 Author chain H； PDBConstruct 29–558； UniProt 27–556 Author chain I； PDBConstruct 29–558； UniProt 27–556 Author chain J； PDBConstruct 29–558； UniProt 27–556 Author chain K； PDBConstruct 29–558； UniProt 27–556 Author chain L； PDBConstruct 29–558； UniProt 27–556 Author chain M； PDBConstruct 29–558； UniProt 27–556 Author chain N； PDBConstruct 29–558； UniProt 27–556

10 kDa heat shock protein, mitochondrial

Homo sapiens

UniProt P61604

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	60 kDa heat shock protein, mitochondrial × 14 （P10809） ADENOSINE-5'-DIPHOSPHATE × 14 MAGNESIUM ION × 14	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CH10_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 1； PDBConstruct 1–102； UniProt 1–102 Author chain 2； PDBConstruct 1–102； UniProt 1–102 Author chain O； PDBConstruct 1–102； UniProt 1–102 Author chain P； PDBConstruct 1–102； UniProt 1–102 Author chain Q； PDBConstruct 1–102； UniProt 1–102 Author chain R； PDBConstruct 1–102； UniProt 1–102 Author chain S； PDBConstruct 1–102； UniProt 1–102 Author chain T； PDBConstruct 1–102； UniProt 1–102 Author chain U； PDBConstruct 1–102； UniProt 1–102 Author chain V； PDBConstruct 1–102； UniProt 1–102 Author chain W； PDBConstruct 1–102； UniProt 1–102 Author chain X； PDBConstruct 1–102； UniProt 1–102 Author chain Y； PDBConstruct 1–102； UniProt 1–102 Author chain Z； PDBConstruct 1–102； UniProt 1–102

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4pj1
Deposition date deposition_date	2014-05-10
Structure title title	Crystal structure of the human mitochondrial chaperonin symmetrical 'football' complex
Keywords keywords	Human, Mitochondrial, Chaperonin, Complex, Symmetric, CHAPERONE; CHAPERONE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4pj1__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4pj1__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4pj1__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	72.57 Å
Rg (electron density)	72.90 Å
Total Rg	72.76 Å
Atom count	65963
Residues	8783
Excluded volume	1188000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4pj1__assembly_1__model_1`	28-meric （28）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	60 kDa heat shock protein, mitochondrial
Molecular weight formula_weight	59859.5 kDa
Mutation mutation	E321K
Source method src_method	man
Copy count entity_count	14

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M,N
Atom count atom_count	65963

MGSHHHHHHHHGSDYDIPTTENLYFQGSAKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKEIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQDAYVLLSEKKISSIQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGKVGKVIVTKDDAMLLKGKGDKAQIEKRIQEIIEQLDVTTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPALDSLTPANEDQKIGIEIIKRTLKIPAMTIAKNAGVEGSLIVEKIMQSSSEVGYDAMAGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLTTAEVVVTEIPKEEKDP

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli-Thermus thermophilus shuttle vector pTRH1T

Entity 2 Entity 2 polymer

Description description	10 kDa heat shock protein, mitochondrial
Molecular weight formula_weight	12335.2 kDa
Source method src_method	man
Copy count entity_count	14

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,P,Q,R,S,T,U,V,W,X,Y,Z,1,2

MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVDKLAAALEHHHHH

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli-Thermus thermophilus shuttle vector pTRH1T

Entity 3 Entity 3 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	14

Entity 4 Entity 4 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	14

▼

6. Fold Classification (SCOP + CATH) 74 domains

SCOP 2.08 (18 domains)

Domain ID domain_id	d4pj11_
Class class	b — All beta proteins
Fold Fold fold	b.35 — GroES-like
Superfamily Superfamily superfamily	b.35.1 — GroES-like
Family Family family	b.35.1.0 — automated matches

Domain ID domain_id	d4pj121
Class class	b — All beta proteins
Fold Fold fold	b.35 — GroES-like
Superfamily Superfamily superfamily	b.35.1 — GroES-like
Family Family family	b.35.1.0 — automated matches

Domain ID domain_id	d4pj122
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d4pj1o_
Class class	b — All beta proteins
Fold Fold fold	b.35 — GroES-like
Superfamily Superfamily superfamily	b.35.1 — GroES-like
Family Family family	b.35.1.0 — automated matches

Domain ID domain_id	d4pj1p1
Class class	b — All beta proteins
Fold Fold fold	b.35 — GroES-like
Superfamily Superfamily superfamily	b.35.1 — GroES-like
Family Family family	b.35.1.0 — automated matches

Domain ID domain_id	d4pj1p2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d4pj1q_
Class class	b — All beta proteins
Fold Fold fold	b.35 — GroES-like
Superfamily Superfamily superfamily	b.35.1 — GroES-like
Family Family family	b.35.1.0 — automated matches

Domain ID domain_id	d4pj1r_
Class class	b — All beta proteins
Fold Fold fold	b.35 — GroES-like
Superfamily Superfamily superfamily	b.35.1 — GroES-like
Family Family family	b.35.1.0 — automated matches

Domain ID domain_id	d4pj1s_
Class class	b — All beta proteins
Fold Fold fold	b.35 — GroES-like
Superfamily Superfamily superfamily	b.35.1 — GroES-like
Family Family family	b.35.1.0 — automated matches

Domain ID domain_id	d4pj1t_
Class class	b — All beta proteins
Fold Fold fold	b.35 — GroES-like
Superfamily Superfamily superfamily	b.35.1 — GroES-like
Family Family family	b.35.1.0 — automated matches

Domain ID domain_id	d4pj1u1
Class class	b — All beta proteins
Fold Fold fold	b.35 — GroES-like
Superfamily Superfamily superfamily	b.35.1 — GroES-like
Family Family family	b.35.1.0 — automated matches

Domain ID domain_id	d4pj1u2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d4pj1v_
Class class	b — All beta proteins
Fold Fold fold	b.35 — GroES-like
Superfamily Superfamily superfamily	b.35.1 — GroES-like
Family Family family	b.35.1.0 — automated matches

Domain ID domain_id	d4pj1w_
Class class	b — All beta proteins
Fold Fold fold	b.35 — GroES-like
Superfamily Superfamily superfamily	b.35.1 — GroES-like
Family Family family	b.35.1.0 — automated matches

Domain ID domain_id	d4pj1x_
Class class	b — All beta proteins
Fold Fold fold	b.35 — GroES-like
Superfamily Superfamily superfamily	b.35.1 — GroES-like
Family Family family	b.35.1.0 — automated matches

Domain ID domain_id	d4pj1y_
Class class	b — All beta proteins
Fold Fold fold	b.35 — GroES-like
Superfamily Superfamily superfamily	b.35.1 — GroES-like
Family Family family	b.35.1.0 — automated matches

Domain ID domain_id	d4pj1z1
Class class	b — All beta proteins
Fold Fold fold	b.35 — GroES-like
Superfamily Superfamily superfamily	b.35.1 — GroES-like
Family Family family	b.35.1.0 — automated matches

Domain ID domain_id	d4pj1z2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (56 domains)

Domain ID domain_id	4pj1100
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	33 — 10 Kd Chaperonin, Protein Cpn10; Chain O
Homologous superfamily homologous superfamily	40 — GroES chaperonin

Domain ID domain_id	4pj1200
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	33 — 10 Kd Chaperonin, Protein Cpn10; Chain O
Homologous superfamily homologous superfamily	40 — GroES chaperonin

Domain ID domain_id	4pj1A01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	560 — GROEL; domain 1
Homologous superfamily homologous superfamily	10 — GroEL-like equatorial domain

Domain ID domain_id	4pj1A02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	260 — GROEL; domain 2
Homologous superfamily homologous superfamily	10 — TCP-1-like chaperonin intermediate domain

Domain ID domain_id	4pj1A03
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	7 — GroEL
Homologous superfamily homologous superfamily	10 — GroEL

Domain ID domain_id	4pj1B01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	560 — GROEL; domain 1
Homologous superfamily homologous superfamily	10 — GroEL-like equatorial domain

Domain ID domain_id	4pj1B02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	260 — GROEL; domain 2
Homologous superfamily homologous superfamily	10 — TCP-1-like chaperonin intermediate domain

Domain ID domain_id	4pj1B03
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	7 — GroEL
Homologous superfamily homologous superfamily	10 — GroEL

Domain ID domain_id	4pj1C01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	560 — GROEL; domain 1
Homologous superfamily homologous superfamily	10 — GroEL-like equatorial domain

Domain ID domain_id	4pj1C02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	260 — GROEL; domain 2
Homologous superfamily homologous superfamily	10 — TCP-1-like chaperonin intermediate domain

Domain ID domain_id	4pj1C03
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	7 — GroEL
Homologous superfamily homologous superfamily	10 — GroEL

Domain ID domain_id	4pj1D01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	560 — GROEL; domain 1
Homologous superfamily homologous superfamily	10 — GroEL-like equatorial domain

Domain ID domain_id	4pj1D02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	260 — GROEL; domain 2
Homologous superfamily homologous superfamily	10 — TCP-1-like chaperonin intermediate domain

Domain ID domain_id	4pj1D03
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	7 — GroEL
Homologous superfamily homologous superfamily	10 — GroEL

Domain ID domain_id	4pj1E01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	560 — GROEL; domain 1
Homologous superfamily homologous superfamily	10 — GroEL-like equatorial domain

Domain ID domain_id	4pj1E02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	260 — GROEL; domain 2
Homologous superfamily homologous superfamily	10 — TCP-1-like chaperonin intermediate domain

Domain ID domain_id	4pj1E03
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	7 — GroEL
Homologous superfamily homologous superfamily	10 — GroEL

Domain ID domain_id	4pj1F01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	560 — GROEL; domain 1
Homologous superfamily homologous superfamily	10 — GroEL-like equatorial domain

Domain ID domain_id	4pj1F02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	260 — GROEL; domain 2
Homologous superfamily homologous superfamily	10 — TCP-1-like chaperonin intermediate domain

Domain ID domain_id	4pj1F03
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	7 — GroEL
Homologous superfamily homologous superfamily	10 — GroEL

Domain ID domain_id	4pj1G01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	560 — GROEL; domain 1
Homologous superfamily homologous superfamily	10 — GroEL-like equatorial domain

Domain ID domain_id	4pj1G02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	260 — GROEL; domain 2
Homologous superfamily homologous superfamily	10 — TCP-1-like chaperonin intermediate domain

Domain ID domain_id	4pj1G03
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	7 — GroEL
Homologous superfamily homologous superfamily	10 — GroEL

Domain ID domain_id	4pj1H01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	560 — GROEL; domain 1
Homologous superfamily homologous superfamily	10 — GroEL-like equatorial domain

Domain ID domain_id	4pj1H02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	260 — GROEL; domain 2
Homologous superfamily homologous superfamily	10 — TCP-1-like chaperonin intermediate domain

Domain ID domain_id	4pj1H03
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	7 — GroEL
Homologous superfamily homologous superfamily	10 — GroEL

Domain ID domain_id	4pj1I01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	560 — GROEL; domain 1
Homologous superfamily homologous superfamily	10 — GroEL-like equatorial domain

Domain ID domain_id	4pj1I02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	260 — GROEL; domain 2
Homologous superfamily homologous superfamily	10 — TCP-1-like chaperonin intermediate domain

Domain ID domain_id	4pj1I03
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	7 — GroEL
Homologous superfamily homologous superfamily	10 — GroEL

Domain ID domain_id	4pj1J01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	560 — GROEL; domain 1
Homologous superfamily homologous superfamily	10 — GroEL-like equatorial domain

Domain ID domain_id	4pj1J02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	260 — GROEL; domain 2
Homologous superfamily homologous superfamily	10 — TCP-1-like chaperonin intermediate domain

Domain ID domain_id	4pj1J03
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	7 — GroEL
Homologous superfamily homologous superfamily	10 — GroEL

Domain ID domain_id	4pj1K01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	560 — GROEL; domain 1
Homologous superfamily homologous superfamily	10 — GroEL-like equatorial domain

Domain ID domain_id	4pj1K02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	260 — GROEL; domain 2
Homologous superfamily homologous superfamily	10 — TCP-1-like chaperonin intermediate domain

Domain ID domain_id	4pj1K03
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	7 — GroEL
Homologous superfamily homologous superfamily	10 — GroEL

Domain ID domain_id	4pj1L01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	560 — GROEL; domain 1
Homologous superfamily homologous superfamily	10 — GroEL-like equatorial domain

Domain ID domain_id	4pj1L02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	260 — GROEL; domain 2
Homologous superfamily homologous superfamily	10 — TCP-1-like chaperonin intermediate domain

Domain ID domain_id	4pj1L03
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	7 — GroEL
Homologous superfamily homologous superfamily	10 — GroEL

Domain ID domain_id	4pj1M01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	560 — GROEL; domain 1
Homologous superfamily homologous superfamily	10 — GroEL-like equatorial domain

Domain ID domain_id	4pj1M02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	260 — GROEL; domain 2
Homologous superfamily homologous superfamily	10 — TCP-1-like chaperonin intermediate domain

Domain ID domain_id	4pj1M03
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	7 — GroEL
Homologous superfamily homologous superfamily	10 — GroEL

Domain ID domain_id	4pj1N01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	560 — GROEL; domain 1
Homologous superfamily homologous superfamily	10 — GroEL-like equatorial domain

Domain ID domain_id	4pj1N02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	260 — GROEL; domain 2
Homologous superfamily homologous superfamily	10 — TCP-1-like chaperonin intermediate domain

Domain ID domain_id	4pj1N03
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	7 — GroEL
Homologous superfamily homologous superfamily	10 — GroEL

Domain ID domain_id	4pj1O00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	33 — 10 Kd Chaperonin, Protein Cpn10; Chain O
Homologous superfamily homologous superfamily	40 — GroES chaperonin

Domain ID domain_id	4pj1P00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	33 — 10 Kd Chaperonin, Protein Cpn10; Chain O
Homologous superfamily homologous superfamily	40 — GroES chaperonin

Domain ID domain_id	4pj1Q00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	33 — 10 Kd Chaperonin, Protein Cpn10; Chain O
Homologous superfamily homologous superfamily	40 — GroES chaperonin

Domain ID domain_id	4pj1R00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	33 — 10 Kd Chaperonin, Protein Cpn10; Chain O
Homologous superfamily homologous superfamily	40 — GroES chaperonin

Domain ID domain_id	4pj1S00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	33 — 10 Kd Chaperonin, Protein Cpn10; Chain O
Homologous superfamily homologous superfamily	40 — GroES chaperonin

Domain ID domain_id	4pj1T00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	33 — 10 Kd Chaperonin, Protein Cpn10; Chain O
Homologous superfamily homologous superfamily	40 — GroES chaperonin

Domain ID domain_id	4pj1U00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	33 — 10 Kd Chaperonin, Protein Cpn10; Chain O
Homologous superfamily homologous superfamily	40 — GroES chaperonin

Domain ID domain_id	4pj1V00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	33 — 10 Kd Chaperonin, Protein Cpn10; Chain O
Homologous superfamily homologous superfamily	40 — GroES chaperonin

Domain ID domain_id	4pj1W00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	33 — 10 Kd Chaperonin, Protein Cpn10; Chain O
Homologous superfamily homologous superfamily	40 — GroES chaperonin

Domain ID domain_id	4pj1X00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	33 — 10 Kd Chaperonin, Protein Cpn10; Chain O
Homologous superfamily homologous superfamily	40 — GroES chaperonin

Domain ID domain_id	4pj1Y00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	33 — 10 Kd Chaperonin, Protein Cpn10; Chain O
Homologous superfamily homologous superfamily	40 — GroES chaperonin

Domain ID domain_id	4pj1Z00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	33 — 10 Kd Chaperonin, Protein Cpn10; Chain O
Homologous superfamily homologous superfamily	40 — GroES chaperonin

▶

Unit-cell length a length_a	199.100 Å
Unit-cell length b length_b	199.100 Å
Unit-cell length c length_c	627.390 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	112

Space group space_group	P 41 21 2
Space-group number int_tables_number	92
Crystal system crystal_system	—

Resolution resolution	3.150 Å
Low-resolution limit resolution_low	49.775 Å
R factor r_factor	0.2422
R_work r_work	0.2407
R_free r_free	0.2704

Crystal structure of the human mitochondrial chaperonin symmetrical 'football' complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

60 kDa heat shock protein, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

10 kDa heat shock protein, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4pj1__assembly_1__model_1

4pj1__assembly_1__model_1 | I(q)

4pj1__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

6. Fold Classification (SCOP + CATH) 74 domains

SCOP 2.08 (18 domains)

CATH v4.4 (56 domains)

7. Citations (2)

Crystal structure of the human mitochondrial chaperonin symmetrical 'football' complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

60 kDa heat shock protein, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

10 kDa heat shock protein, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4pj1__assembly_1__model_1

4pj1__assembly_1__model_1 | I(q)

4pj1__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

6. Fold Classification (SCOP + CATH) 74 domains

SCOP 2.08 (18 domains)

CATH v4.4 (56 domains)

7. Citations (2)