SAXSdb — 4q5j

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein BRASSINOSTEROID INSENSITIVE 1

Arabidopsis thaliana

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	BRI1 kinase inhibitor 1 × 1 （Q9FMZ0） PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 water × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	BRI1 kinase inhibitor 1 × 1 （Q9FMZ0） PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BRI1_ARATH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 24–341； UniProt 863–1180 Author chain B； PDBConstruct 24–341； UniProt 863–1180

BRI1 kinase inhibitor 1

OrganismNot specified

UniProt Q9FMZ0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Protein BRASSINOSTEROID INSENSITIVE 1 × 1 （O22476） PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 water × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Protein BRASSINOSTEROID INSENSITIVE 1 × 1 （O22476） PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BKI1_ARATH
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 1–20； UniProt 306–325 Author chain F； PDBConstruct 1–20； UniProt 306–325

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4q5j
Deposition date deposition_date	2014-04-17
Structure title title	Crystal structure of SeMet derivative BRI1 in complex with BKI1
Keywords keywords	kinase domain, ATP binding, Phosphorylation, SeMet labelled, Membrane, TRANSFERASE-TRANSFERASE INHIBITOR complex; TRANSFERASE/TRANSFERASE INHIBITOR
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4q5j__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4q5j__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4q5j__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	20.87 Å
Rg (electron density)	19.98 Å
Total Rg	20.73 Å
Atom count	2459
Residues	297
Excluded volume	43786 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4q5j__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4q5j__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Protein BRASSINOSTEROID INSENSITIVE 1
Molecular weight formula_weight	38972.1 kDa
EC 编号 ec_number	2.7.10.1, 2.7.11.1
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	4912

MGSSHHHHHHSQDLEVLFQGPHMAFEKPLRKLTFADLLQATNGFHNDSLIGSGGFGDVYKAILKDGSAVAIKKLIHVSGQGDREFMAEMETIGKIKHRNLVPLLGYCKVGDERLLVYEFMKYGSLEDVLHDPKKAGVKLNWSTRRKIAIGSARGLAFLHHNCSPHIIHRDMKSSNVLLDENLEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSPDFGDNNLVGWVKQHAKLRISDVFDPELMKEDPALEIELLQHLKVAVACLDDRAWRRPTMVQVMAMFKEIQAGSGIDSQSTIRSIEDGGFST

Source Source

Source organism organism	Arabidopsis thaliana
Common name common_name	mouse-ear cress,thale-cress
NCBI taxonomy ID ncbi_taxonomy_id	3702
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	BRI1 kinase inhibitor 1
Molecular weight formula_weight	2281.6 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,E

STMEELQAAIQAAIAHCKNSY

Entity 3 Entity 3 non-polymer

Description description	PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER
Molecular weight formula_weight	506.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	2

▶

Unit-cell length a length_a	63.715 Å
Unit-cell length b length_b	80.288 Å
Unit-cell length c length_c	80.557 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	109.55 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.772 Å
Low-resolution limit resolution_low	38.409 Å
R factor r_factor	0.2035
R_work r_work	0.2005
R_free r_free	0.2589

Crystal structure of SeMet derivative BRI1 in complex with BKI1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein BRASSINOSTEROID INSENSITIVE 1

State in the Current Structure

Other States of the Same Protein in the Database

BRI1 kinase inhibitor 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4q5j__assembly_1__model_1

4q5j__assembly_1__model_1 | I(q)

4q5j__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)

Crystal structure of SeMet derivative BRI1 in complex with BKI1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein BRASSINOSTEROID INSENSITIVE 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

BRI1 kinase inhibitor 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4q5j__assembly_1__model_1

4q5j__assembly_1__model_1 | I(q)

4q5j__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)