SAXSdb — 4rig

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Glycosyl transferase

Streptomyces fradiae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Homooligomer	Protein 2	MAGNESIUM ION × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9RPA7_STRFR
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 51–62； UniProt 38–49 Author chain B； PDBConstruct 51–62； UniProt 38–49

Glycosyl transferase

Streptomyces fradiae

UniProt Q9ZGC0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Homooligomer	Protein 2	MAGNESIUM ION × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9ZGC0_STRCY
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–50； UniProt 1–50 Author chain A； PDBConstruct 63–373； UniProt 63–373 Author chain B； PDBConstruct 1–50； UniProt 1–50 Author chain B； PDBConstruct 63–373； UniProt 63–373

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4rig
Deposition date deposition_date	2014-10-06
Structure title title	Chimeric Glycosyltransferase LanGT2S8Ac
Keywords keywords	GT fold, C-glycosylating glycosyltransferase, transferase; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4rig__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4rig__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4rig__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	28.07 Å
Rg (electron density)	26.73 Å
Total Rg	27.55 Å
Atom count	5233
Residues	703
Excluded volume	93186 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4rig__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Glycosyl transferase
Molecular weight formula_weight	40453.2 kDa
Mutation mutation	S8A
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	5450

MKILFVAAGSPATVFALAPLATAARNAGHDVFMGAVEDMVPYIASAGIPAVATTDLPIRHFITMDREGNPVRMPETPEEELDFAGHWFGRMAAGSMDALREVTANWRPDLVVGGSMSFAAALIAAELGVPYVRQAWDTGDAWRTDPAASDELRPELRALGLDRLPDPALFVDICPPSLRPADAPPAQMMRWVPANGQRRLEPWMYTKGNRPRILVTSGSRLVFAKKTGFLRGLVADMAALDAEVVIATLDEVAEELRTELPGVRAGWVPLDVVVPTCDVVVHHAGGVTALTAMNAGVPQLIVPQGGNFVEAGLRISDFGAAITVDENTPEAVEKACGELIGNPSYAERARELSAEIAALPLPAEVVGALEGLVENLYFQ

Source Source

Source organism organism	Streptomyces fradiae
NCBI taxonomy ID ncbi_taxonomy_id	1906
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	217

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d4riga1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.87 — UDP-Glycosyltransferase/glycogen phosphorylase
Superfamily Superfamily superfamily	c.87.1 — UDP-Glycosyltransferase/glycogen phosphorylase
Family Family family	c.87.1.0 — automated matches

Domain ID domain_id	d4riga2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d4rigb1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.87 — UDP-Glycosyltransferase/glycogen phosphorylase
Superfamily Superfamily superfamily	c.87.1 — UDP-Glycosyltransferase/glycogen phosphorylase
Family Family family	c.87.1.0 — automated matches

Domain ID domain_id	d4rigb2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (4 domains)

Domain ID domain_id	4rigA01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	2000 — Glycogen Phosphorylase B;

Domain ID domain_id	4rigA02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	2000 — Glycogen Phosphorylase B;

Domain ID domain_id	4rigB01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	2000 — Glycogen Phosphorylase B;

Domain ID domain_id	4rigB02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	2000 — Glycogen Phosphorylase B;

▶

Unit-cell length a length_a	52.943 Å
Unit-cell length b length_b	59.109 Å
Unit-cell length c length_c	63.111 Å
Unit-cell angle α angle_alpha	79.30 °
Unit-cell angle β angle_beta	71.72 °
Unit-cell angle γ angle_gamma	87.69 °
Molecules per unit cell Z z_pdb	2

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	1.900 Å
Low-resolution limit resolution_low	46.010 Å
R factor r_factor	0.2050
R_work r_work	0.2031
R_free r_free	0.2406

Chimeric Glycosyltransferase LanGT2S8Ac

1. Protein Identity and Related Structures Protein Identity & Related Structures

Glycosyl transferase

State in the Current Structure

Other States of the Same Protein in the Database

Glycosyl transferase

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4rig__assembly_1__model_1

4rig__assembly_1__model_1 | I(q)

4rig__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Chimeric Glycosyltransferase LanGT2S8Ac

1. Protein Identity and Related Structures Protein Identity & Related Structures

Glycosyl transferase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Glycosyl transferase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4rig__assembly_1__model_1

4rig__assembly_1__model_1 | I(q)

4rig__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)