4u39

Crystal Structure of FtsZ:MciZ Complex from Bacillus subtilis

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cell division protein FtsZ

Bacillus subtilis

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Cell division factor × 1 （L8EBJ9） PHOSPHATE ION × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Cell division factor × 1 （L8EBJ9） PHOSPHATE ION × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Cell division factor × 1 （L8EBJ9） PHOSPHATE ION × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Cell division factor × 1 （L8EBJ9） PHOSPHATE ION × 2	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 2	Cell division factor × 1 （L8EBJ9） PHOSPHATE ION × 1	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 2	Cell division factor × 1 （L8EBJ9） PHOSPHATE ION × 1	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 2	Cell division factor × 1 （L8EBJ9） PHOSPHATE ION × 2	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 2	Cell division factor × 1 （L8EBJ9） PHOSPHATE ION × 2	Consistent with protein count
9	Protein heterocomplex	Heteromer	Protein 2	Cell division factor × 1 （L8EBJ9） PHOSPHATE ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FTSZ_BACSU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–305； UniProt 12–315 Author chain B； PDBConstruct 2–305； UniProt 12–315 Author chain C； PDBConstruct 2–305； UniProt 12–315 Author chain D； PDBConstruct 2–305； UniProt 12–315 Author chain E； PDBConstruct 2–305； UniProt 12–315 Author chain F； PDBConstruct 2–305； UniProt 12–315 Author chain G； PDBConstruct 2–305； UniProt 12–315 Author chain H； PDBConstruct 2–305； UniProt 12–315 Author chain I； PDBConstruct 2–305； UniProt 12–315

Cell division factor

Bacillus subtilis

UniProt L8EBJ9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Cell division protein FtsZ × 1 （P17865） PHOSPHATE ION × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Cell division protein FtsZ × 1 （P17865） PHOSPHATE ION × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Cell division protein FtsZ × 1 （P17865） PHOSPHATE ION × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Cell division protein FtsZ × 1 （P17865） PHOSPHATE ION × 2	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 2	Cell division protein FtsZ × 1 （P17865） PHOSPHATE ION × 1	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 2	Cell division protein FtsZ × 1 （P17865） PHOSPHATE ION × 1	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 2	Cell division protein FtsZ × 1 （P17865） PHOSPHATE ION × 2	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 2	Cell division protein FtsZ × 1 （P17865） PHOSPHATE ION × 2	Consistent with protein count
9	Protein heterocomplex	Heteromer	Protein 2	Cell division protein FtsZ × 1 （P17865） PHOSPHATE ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	L8EBJ9_BACSU
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain J； PDBConstruct 21–60； UniProt 1–40 Author chain K； PDBConstruct 21–60； UniProt 1–40 Author chain L； PDBConstruct 21–60； UniProt 1–40 Author chain M； PDBConstruct 21–60； UniProt 1–40 Author chain N； PDBConstruct 21–60； UniProt 1–40 Author chain O； PDBConstruct 21–60； UniProt 1–40 Author chain P； PDBConstruct 21–60； UniProt 1–40 Author chain Q； PDBConstruct 21–60； UniProt 1–40 Author chain R； PDBConstruct 21–60； UniProt 1–40

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4u39
Deposition date deposition_date	2014-07-19
Structure title title	Crystal Structure of FtsZ:MciZ Complex from Bacillus subtilis
Keywords keywords	FtsZ, MciZ, protein complex, CELL CYCLE; CELL CYCLE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4u39__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4u39__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4u39__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	19.42 Å
Rg (electron density)	18.38 Å
Total Rg	19.24 Å
Atom count	2047
Residues	304
Excluded volume	35989 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4u39__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4u39__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`4u39__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`4u39__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`4u39__assembly_5__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`4u39__assembly_6__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
7	1	`4u39__assembly_7__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
8	1	`4u39__assembly_8__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
9	1	`4u39__assembly_9__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Cell division protein FtsZ
Molecular weight formula_weight	31476.9 kDa
Source method src_method	man
Copy count entity_count	9

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I
Atom count atom_count	19225

MASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINLDFADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLEAAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENLKDEIVVTVIATGF

Source Source

Source organism organism	Bacillus subtilis
NCBI taxonomy ID ncbi_taxonomy_id	1423
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Cell division factor
Molecular weight formula_weight	6957.1 kDa
Source method src_method	man
Copy count entity_count	9

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,K,L,M,N,O,P,Q,R

MGSSHHHHHHSSGLVPRGSHMKVHRMPKGVVLVGKAWEIRAKLKEYGRTFQYVKDWISKP

Source Source

Source organism organism	Bacillus subtilis
NCBI taxonomy ID ncbi_taxonomy_id	1423
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	16

▼

6. Fold Classification (SCOP + CATH) 35 domains

SCOP 2.08 (17 domains)

Domain ID domain_id	d4u39a1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.32 — Tubulin nucleotide-binding domain-like
Superfamily Superfamily superfamily	c.32.1 — Tubulin nucleotide-binding domain-like
Family Family family	c.32.1.0 — automated matches

Domain ID domain_id	d4u39a2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.79 — Bacillus chorismate mutase-like
Superfamily Superfamily superfamily	d.79.2 — Tubulin C-terminal domain-like
Family Family family	d.79.2.0 — automated matches

Domain ID domain_id	d4u39b1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.32 — Tubulin nucleotide-binding domain-like
Superfamily Superfamily superfamily	c.32.1 — Tubulin nucleotide-binding domain-like
Family Family family	c.32.1.0 — automated matches

Domain ID domain_id	d4u39b2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.79 — Bacillus chorismate mutase-like
Superfamily Superfamily superfamily	d.79.2 — Tubulin C-terminal domain-like
Family Family family	d.79.2.0 — automated matches

Domain ID domain_id	d4u39c1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.32 — Tubulin nucleotide-binding domain-like
Superfamily Superfamily superfamily	c.32.1 — Tubulin nucleotide-binding domain-like
Family Family family	c.32.1.0 — automated matches

Domain ID domain_id	d4u39c2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.79 — Bacillus chorismate mutase-like
Superfamily Superfamily superfamily	d.79.2 — Tubulin C-terminal domain-like
Family Family family	d.79.2.0 — automated matches

Domain ID domain_id	d4u39d1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.32 — Tubulin nucleotide-binding domain-like
Superfamily Superfamily superfamily	c.32.1 — Tubulin nucleotide-binding domain-like
Family Family family	c.32.1.0 — automated matches

Domain ID domain_id	d4u39d2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.79 — Bacillus chorismate mutase-like
Superfamily Superfamily superfamily	d.79.2 — Tubulin C-terminal domain-like
Family Family family	d.79.2.0 — automated matches

Domain ID domain_id	d4u39e1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.32 — Tubulin nucleotide-binding domain-like
Superfamily Superfamily superfamily	c.32.1 — Tubulin nucleotide-binding domain-like
Family Family family	c.32.1.0 — automated matches

Domain ID domain_id	d4u39e2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.79 — Bacillus chorismate mutase-like
Superfamily Superfamily superfamily	d.79.2 — Tubulin C-terminal domain-like
Family Family family	d.79.2.0 — automated matches

Domain ID domain_id	d4u39f1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.32 — Tubulin nucleotide-binding domain-like
Superfamily Superfamily superfamily	c.32.1 — Tubulin nucleotide-binding domain-like
Family Family family	c.32.1.0 — automated matches

Domain ID domain_id	d4u39f2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.79 — Bacillus chorismate mutase-like
Superfamily Superfamily superfamily	d.79.2 — Tubulin C-terminal domain-like
Family Family family	d.79.2.0 — automated matches

Domain ID domain_id	d4u39g1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.32 — Tubulin nucleotide-binding domain-like
Superfamily Superfamily superfamily	c.32.1 — Tubulin nucleotide-binding domain-like
Family Family family	c.32.1.0 — automated matches

Domain ID domain_id	d4u39g2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.79 — Bacillus chorismate mutase-like
Superfamily Superfamily superfamily	d.79.2 — Tubulin C-terminal domain-like
Family Family family	d.79.2.0 — automated matches

Domain ID domain_id	d4u39h1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.32 — Tubulin nucleotide-binding domain-like
Superfamily Superfamily superfamily	c.32.1 — Tubulin nucleotide-binding domain-like
Family Family family	c.32.1.0 — automated matches

Domain ID domain_id	d4u39i1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.32 — Tubulin nucleotide-binding domain-like
Superfamily Superfamily superfamily	c.32.1 — Tubulin nucleotide-binding domain-like
Family Family family	c.32.1.0 — automated matches

Domain ID domain_id	d4u39i2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.79 — Bacillus chorismate mutase-like
Superfamily Superfamily superfamily	d.79.2 — Tubulin C-terminal domain-like
Family Family family	d.79.2.0 — automated matches

CATH v4.4 (18 domains)

Domain ID domain_id	4u39A01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1440 — Tubulin/FtsZ, GTPase domain

Domain ID domain_id	4u39A02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1330 — 60s Ribosomal Protein L30; Chain: A;
Homologous superfamily homologous superfamily	20 — Tubulin/FtsZ, C-terminal domain

Domain ID domain_id	4u39B01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1440 — Tubulin/FtsZ, GTPase domain

Domain ID domain_id	4u39B02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1330 — 60s Ribosomal Protein L30; Chain: A;
Homologous superfamily homologous superfamily	20 — Tubulin/FtsZ, C-terminal domain

Domain ID domain_id	4u39C01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1440 — Tubulin/FtsZ, GTPase domain

Domain ID domain_id	4u39C02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1330 — 60s Ribosomal Protein L30; Chain: A;
Homologous superfamily homologous superfamily	20 — Tubulin/FtsZ, C-terminal domain

Domain ID domain_id	4u39D01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1440 — Tubulin/FtsZ, GTPase domain

Domain ID domain_id	4u39D02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1330 — 60s Ribosomal Protein L30; Chain: A;
Homologous superfamily homologous superfamily	20 — Tubulin/FtsZ, C-terminal domain

Domain ID domain_id	4u39E01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1440 — Tubulin/FtsZ, GTPase domain

Domain ID domain_id	4u39E02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1330 — 60s Ribosomal Protein L30; Chain: A;
Homologous superfamily homologous superfamily	20 — Tubulin/FtsZ, C-terminal domain

Domain ID domain_id	4u39F01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1440 — Tubulin/FtsZ, GTPase domain

Domain ID domain_id	4u39F02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1330 — 60s Ribosomal Protein L30; Chain: A;
Homologous superfamily homologous superfamily	20 — Tubulin/FtsZ, C-terminal domain

Domain ID domain_id	4u39G01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1440 — Tubulin/FtsZ, GTPase domain

Domain ID domain_id	4u39G02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1330 — 60s Ribosomal Protein L30; Chain: A;
Homologous superfamily homologous superfamily	20 — Tubulin/FtsZ, C-terminal domain

Domain ID domain_id	4u39H01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1440 — Tubulin/FtsZ, GTPase domain

Domain ID domain_id	4u39H02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1330 — 60s Ribosomal Protein L30; Chain: A;
Homologous superfamily homologous superfamily	20 — Tubulin/FtsZ, C-terminal domain

Domain ID domain_id	4u39I01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1440 — Tubulin/FtsZ, GTPase domain

Domain ID domain_id	4u39I02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1330 — 60s Ribosomal Protein L30; Chain: A;
Homologous superfamily homologous superfamily	20 — Tubulin/FtsZ, C-terminal domain

▶

Unit-cell length a length_a	167.360 Å
Unit-cell length b length_b	167.360 Å
Unit-cell length c length_c	528.640 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	108

Space group space_group	P 65 2 2
Space-group number int_tables_number	179
Crystal system crystal_system	—

Resolution resolution	3.194 Å
Low-resolution limit resolution_low	46.593 Å
R factor r_factor	0.2349
R_work r_work	0.2319
R_free r_free	0.2918

Crystal Structure of FtsZ:MciZ Complex from Bacillus subtilis

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cell division protein FtsZ

State in the Current Structure

Other States of the Same Protein in the Database

Cell division factor

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4u39__assembly_2__model_1

4u39__assembly_2__model_1 | I(q)

4u39__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

6. Fold Classification (SCOP + CATH) 35 domains

SCOP 2.08 (17 domains)

CATH v4.4 (18 domains)

7. Citations (1)

Crystal Structure of FtsZ:MciZ Complex from Bacillus subtilis

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cell division protein FtsZ

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cell division factor

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4u39__assembly_2__model_1

4u39__assembly_2__model_1 | I(q)

4u39__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

6. Fold Classification (SCOP + CATH) 35 domains

SCOP 2.08 (17 domains)

CATH v4.4 (18 domains)

7. Citations (1)