4uyo

Structure of delta7-DgkA in 7.9 MAG by serial femtosecond crystatallography to 2.18 angstrom resolution

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DIACYLGLYCEROL KINASE-DELTA 7

ESCHERICHIA COLI K12

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 3	(2S)-2,3-dihydroxypropyl (7Z)-hexadec-7-enoate × 3 (2R)-2,3-dihydroxypropyl (7Z)-hexadec-7-enoate × 2 water × 3	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 3	(2S)-2,3-dihydroxypropyl (7Z)-hexadec-7-enoate × 2 (2R)-2,3-dihydroxypropyl (7Z)-hexadec-7-enoate × 2 ZINC ION × 1 CITRATE ANION × 1 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	KDGL_ECOLI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 10–130； UniProt 2–122 Author chain B； PDBConstruct 10–130； UniProt 2–122 Author chain C； PDBConstruct 10–130； UniProt 2–122 Author chain D； PDBConstruct 10–130； UniProt 2–122 Author chain E； PDBConstruct 10–130； UniProt 2–122 Author chain F； PDBConstruct 10–130； UniProt 2–122

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4uyo
Deposition date deposition_date	2014-09-02
Structure title title	Structure of delta7-DgkA in 7.9 MAG by serial femtosecond crystatallography to 2.18 angstrom resolution
Keywords keywords	;TRANSFERASE, 7.9 MAG, IN MESO CRYSTALLIZATION, LIPID CUBIC PHASE, LIPIDIC CUBIC PHASE, LIPID MESOPHASE, LIPIDIC MESOPHASE, MEMBRANE PROTEIN, MICROCRYSTALS, MONOACYLGLYCEROL, ROOM TEMPERATURE CRYSTALLOGRAPHY, SERIAL FEMTOSECOND CRYSTALLOGRAPHY, X-RAY FREE-ELECTRON LASER ;; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4uyo__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4uyo__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4uyo__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	20.86 Å
Rg (electron density)	19.63 Å
Total Rg	20.44 Å
Atom count	2429
Residues	304
Excluded volume	44912 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4uyo__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4uyo__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	DIACYLGLYCEROL KINASE-DELTA 7
Molecular weight formula_weight	14204.5 kDa
EC 编号 ec_number	2.7.1.107
Mutation mutation	YES
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F
Atom count atom_count	5225

GHHHHHHELANNTTGFTRIIKAAGYSWKGLRAAWINEAAFRQEGVAVLLCVVIAAWLDVDAVTRVLLISSVMLVMIVELLNSAIEAVVDRIGSEYHELSGRAKDLGSAAVLIAIIDAVITWAILLWSHFG

Source Source

Source organism organism	ESCHERICHIA COLI K12
NCBI taxonomy ID ncbi_taxonomy_id	83333
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 non-polymer

Description description	(2S)-2,3-dihydroxypropyl (7Z)-hexadec-7-enoate
Molecular weight formula_weight	328.5 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 3 Entity 3 non-polymer

Description description	(2R)-2,3-dihydroxypropyl (7Z)-hexadec-7-enoate
Molecular weight formula_weight	328.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 4 Entity 4 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 non-polymer

Description description	CITRATE ANION
Molecular weight formula_weight	189.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	85

▼

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (6 domains)

Domain ID domain_id	d4uyoa_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.62 — Diacylglycerol kinase (DgkA)-like
Superfamily Superfamily superfamily	f.62.1 — Diacylglycerol kinase (DgkA)-like
Family Family family	f.62.1.1 — Diacylglycerol kinase (DgkA)-like

Domain ID domain_id	d4uyob_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.62 — Diacylglycerol kinase (DgkA)-like
Superfamily Superfamily superfamily	f.62.1 — Diacylglycerol kinase (DgkA)-like
Family Family family	f.62.1.1 — Diacylglycerol kinase (DgkA)-like

Domain ID domain_id	d4uyoc_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.62 — Diacylglycerol kinase (DgkA)-like
Superfamily Superfamily superfamily	f.62.1 — Diacylglycerol kinase (DgkA)-like
Family Family family	f.62.1.1 — Diacylglycerol kinase (DgkA)-like

Domain ID domain_id	d4uyod_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.62 — Diacylglycerol kinase (DgkA)-like
Superfamily Superfamily superfamily	f.62.1 — Diacylglycerol kinase (DgkA)-like
Family Family family	f.62.1.1 — Diacylglycerol kinase (DgkA)-like

Domain ID domain_id	d4uyoe_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.62 — Diacylglycerol kinase (DgkA)-like
Superfamily Superfamily superfamily	f.62.1 — Diacylglycerol kinase (DgkA)-like
Family Family family	f.62.1.1 — Diacylglycerol kinase (DgkA)-like

Domain ID domain_id	d4uyof_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.62 — Diacylglycerol kinase (DgkA)-like
Superfamily Superfamily superfamily	f.62.1 — Diacylglycerol kinase (DgkA)-like
Family Family family	f.62.1.1 — Diacylglycerol kinase (DgkA)-like

CATH v4.4 (6 domains)

Domain ID domain_id	4uyoA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	3610 —

Domain ID domain_id	4uyoB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	3610 —

Domain ID domain_id	4uyoC00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	3610 —

Domain ID domain_id	4uyoD00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	3610 —

Domain ID domain_id	4uyoE00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	3610 —

Domain ID domain_id	4uyoF00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	3610 —

▶

Unit-cell length a length_a	75.300 Å
Unit-cell length b length_b	91.800 Å
Unit-cell length c length_c	141.700 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.180 Å
Low-resolution limit resolution_low	40.013 Å
R factor r_factor	0.2090
R_work r_work	0.2076
R_free r_free	0.2362

Structure of delta7-DgkA in 7.9 MAG by serial femtosecond crystatallography to 2.18 angstrom resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

DIACYLGLYCEROL KINASE-DELTA 7

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4uyo__assembly_1__model_1

4uyo__assembly_1__model_1 | I(q)

4uyo__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (6 domains)

CATH v4.4 (6 domains)

7. Citations (1)

Structure of delta7-DgkA in 7.9 MAG by serial femtosecond crystatallography to 2.18 angstrom resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

DIACYLGLYCEROL KINASE-DELTA 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4uyo__assembly_1__model_1

4uyo__assembly_1__model_1 | I(q)

4uyo__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (6 domains)

CATH v4.4 (6 domains)

7. Citations (1)