SAXSdb — 4uyq

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cellulosomal scaffoldin anchoring protein C

Acetivibrio cellulolyticus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Cellulosomal scaffoldin adaptor protein B × 1 （Q7WYN3） CALCIUM ION × 3 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7WYN2_9FIRM
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–143； UniProt 326–467

Cellulosomal scaffoldin adaptor protein B

Acetivibrio cellulolyticus

UniProt Q7WYN3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Cellulosomal scaffoldin anchoring protein C × 1 （Q7WYN2） CALCIUM ION × 3 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7WYN3_9FIRM
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–75； UniProt 868–942

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4uyq
Deposition date deposition_date	2014-09-02
Structure title title	High resolution structure of the third cohesin ScaC in complex with the ScaB dockerin with a mutation in the C-terminal helix (IN to SI) from Acetivibrio cellulolyticus displaying a type I interaction.
Keywords keywords	;CELL ADHESION-PROTEIN BINDING COMPLEX, CELLULOSOME, TYPE 1 COHESIN-DOCKERIN INTEREACTIONS, ADAPTOR SCAFFOLDIN SCAB, ANCHORING SCAFFOLDING SCAC ;; CELL ADHESION/PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4uyq__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4uyq__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4uyq__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	19.08 Å
Rg (electron density)	18.19 Å
Total Rg	19.23 Å
Atom count	1665
Residues	217
Excluded volume	29761 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4uyq__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Cellulosomal scaffoldin anchoring protein C
Molecular weight formula_weight	16512.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	2003

MLQVDIGSTSGKAGSVVSVPITFTNVPKSGIYALSFRTNFDPQKVTVASIDAGSLIENASDFTTYYNNENGFASMTFEAPVDRARIIDSDGVFATINFKVSDSAKVGELYNITTNSAYTSFYYSGTDEIKNVVYNDGKIEVIALEHHHHHH

Source Source

Source organism organism	Acetivibrio cellulolyticus
NCBI taxonomy ID ncbi_taxonomy_id	35830
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Cellulosomal scaffoldin adaptor protein B
Molecular weight formula_weight	8382.5 kDa
Mutation mutation	YES
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

KFIYGDVDGNGSVRINDAVLIRDYVLGKINEFPYEYGMLAADVDGNGSIKSIDAVLVRDYVLGKIFLFPVEEKEE

Source Source

Source organism organism	Acetivibrio cellulolyticus
NCBI taxonomy ID ncbi_taxonomy_id	35830
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	319

▼

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d4uyqa1
Class class	b — All beta proteins
Fold Fold fold	b.2 — Common fold of diphtheria toxin/transcription factors/cytochrome f
Superfamily Superfamily superfamily	b.2.2 — Carbohydrate-binding domain
Family Family family	b.2.2.0 — automated matches

Domain ID domain_id	d4uyqa2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d4uyqa3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d4uyqb_
Class class	a — All alpha proteins
Fold Fold fold	a.139 — Type I dockerin domain
Superfamily Superfamily superfamily	a.139.1 — Type I dockerin domain
Family Family family	a.139.1.0 — automated matches

CATH v4.4 (2 domains)

Domain ID domain_id	4uyqA01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	680 —

Domain ID domain_id	4uyqB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1330 — Type 1 dockerin domain
Homologous superfamily homologous superfamily	10 — Dockerin domain

▶

Unit-cell length a length_a	68.170 Å
Unit-cell length b length_b	68.170 Å
Unit-cell length c length_c	57.140 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 43
Space-group number int_tables_number	78
Crystal system crystal_system	—

Resolution resolution	1.810 Å
Low-resolution limit resolution_low	68.170 Å
R factor r_factor	0.1519
R_work r_work	0.1497
R_free r_free	0.1950

High resolution structure of the third cohesin ScaC in complex with the ScaB dockerin with a mutation in the C-terminal helix (IN to SI) from Acetivibrio cellulolyticus displaying a type I interaction.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cellulosomal scaffoldin anchoring protein C

State in the Current Structure

Other States of the Same Protein in the Database

Cellulosomal scaffoldin adaptor protein B

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4uyq__assembly_1__model_1

4uyq__assembly_1__model_1 | I(q)

4uyq__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

CATH v4.4 (2 domains)

7. Citations (2)

High resolution structure of the third cohesin ScaC in complex with the ScaB dockerin with a mutation in the C-terminal helix (IN to SI) from Acetivibrio cellulolyticus displaying a type I interaction.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cellulosomal scaffoldin anchoring protein C

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cellulosomal scaffoldin adaptor protein B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4uyq__assembly_1__model_1

4uyq__assembly_1__model_1 | I(q)

4uyq__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

CATH v4.4 (2 domains)

7. Citations (2)