SAXSdb — 4v4m

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Coat protein

Tobacco necrosis satellite virus 1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 60	CALCIUM ION × 92 water × 60	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COAT_STNV1
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 0； PDBConstruct 1–196； UniProt 1–196 Author chain 1； PDBConstruct 1–196； UniProt 1–196 Author chain 2； PDBConstruct 1–196； UniProt 1–196 Author chain 3； PDBConstruct 1–196； UniProt 1–196 Author chain 4； PDBConstruct 1–196； UniProt 1–196 Author chain 5； PDBConstruct 1–196； UniProt 1–196 Author chain 6； PDBConstruct 1–196； UniProt 1–196 Author chain 7； PDBConstruct 1–196； UniProt 1–196 Author chain A； PDBConstruct 1–196； UniProt 1–196 Author chain B； PDBConstruct 1–196； UniProt 1–196 Author chain C； PDBConstruct 1–196； UniProt 1–196 Author chain D； PDBConstruct 1–196； UniProt 1–196 Author chain E； PDBConstruct 1–196； UniProt 1–196 Author chain F； PDBConstruct 1–196； UniProt 1–196 Author chain G； PDBConstruct 1–196； UniProt 1–196 Author chain H； PDBConstruct 1–196； UniProt 1–196 Author chain I； PDBConstruct 1–196； UniProt 1–196 Author chain J； PDBConstruct 1–196； UniProt 1–196 Author chain K； PDBConstruct 1–196； UniProt 1–196 Author chain L； PDBConstruct 1–196； UniProt 1–196 Author chain M； PDBConstruct 1–196； UniProt 1–196 Author chain N； PDBConstruct 1–196； UniProt 1–196 Author chain O； PDBConstruct 1–196； UniProt 1–196 Author chain P； PDBConstruct 1–196； UniProt 1–196 Author chain Q； PDBConstruct 1–196； UniProt 1–196 Author chain R； PDBConstruct 1–196； UniProt 1–196 Author chain S； PDBConstruct 1–196； UniProt 1–196 Author chain T； PDBConstruct 1–196； UniProt 1–196 Author chain U； PDBConstruct 1–196； UniProt 1–196 Author chain V； PDBConstruct 1–196； UniProt 1–196 Author chain W； PDBConstruct 1–196； UniProt 1–196 Author chain X； PDBConstruct 1–196； UniProt 1–196 Author chain Y； PDBConstruct 1–196； UniProt 1–196 Author chain Z； PDBConstruct 1–196； UniProt 1–196 Author chain a； PDBConstruct 1–196； UniProt 1–196 Author chain b； PDBConstruct 1–196； UniProt 1–196 Author chain c； PDBConstruct 1–196； UniProt 1–196 Author chain d； PDBConstruct 1–196； UniProt 1–196 Author chain e； PDBConstruct 1–196； UniProt 1–196 Author chain f； PDBConstruct 1–196； UniProt 1–196 Author chain g； PDBConstruct 1–196； UniProt 1–196 Author chain h； PDBConstruct 1–196； UniProt 1–196 Author chain i； PDBConstruct 1–196； UniProt 1–196 Author chain j； PDBConstruct 1–196； UniProt 1–196 Author chain k； PDBConstruct 1–196； UniProt 1–196 Author chain l； PDBConstruct 1–196； UniProt 1–196 Author chain m； PDBConstruct 1–196； UniProt 1–196 Author chain n； PDBConstruct 1–196； UniProt 1–196 Author chain o； PDBConstruct 1–196； UniProt 1–196 Author chain p； PDBConstruct 1–196； UniProt 1–196 Author chain q； PDBConstruct 1–196； UniProt 1–196 Author chain r； PDBConstruct 1–196； UniProt 1–196 Author chain s； PDBConstruct 1–196； UniProt 1–196 Author chain t； PDBConstruct 1–196； UniProt 1–196 Author chain u； PDBConstruct 1–196； UniProt 1–196 Author chain v； PDBConstruct 1–196； UniProt 1–196 Author chain w； PDBConstruct 1–196； UniProt 1–196 Author chain x； PDBConstruct 1–196； UniProt 1–196 Author chain y； PDBConstruct 1–196； UniProt 1–196 Author chain z； PDBConstruct 1–196； UniProt 1–196

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4v4m
Deposition date deposition_date	2011-04-28
Structure title title	1.45 Angstrom Structure of STNV coat protein
Keywords keywords	jelly-roll beta-sandwich, virus, coat protein; VIRUS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4v4m__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4v4m__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4v4m__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	78.17 Å
Rg (electron density)	77.34 Å
Total Rg	77.36 Å
Atom count	85712
Residues	11040
Excluded volume	1520100 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4v4m__assembly_1__model_1`	60-meric （60）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Coat protein
Molecular weight formula_weight	21739.6 kDa
Source method src_method	man
Copy count entity_count	60

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e,f,g,h,i,j,k,l,m,n,o,p,q,r,s,t,u,v,w,x,y,z,0,1,2,3,4,5,6,7,A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,a,b,c,d
Atom count atom_count	102135

MAKQQNNRRKSATMRAVKRMINTHLEHKRFALINSGNTNATAGTVQNLSNGIIQGDDINQRSGDQVRIVSHKLHVRGTAITVSQTFRFIWFRDNMNRGTTPTVLEVLNTANFMSQYNPITLQQKRFTILKDVTLNCSLTGESIKDRIINLPGQLVNYNGATAVAASNGPGAIFMLQIGDSLVGLWDSSYEAVYTDA

Source Source

Source organism organism	Tobacco necrosis satellite virus 1
NCBI taxonomy ID ncbi_taxonomy_id	12445
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	92

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	15347

▶

Unit-cell length a length_a	307.585 Å
Unit-cell length b length_b	302.265 Å
Unit-cell length c length_c	181.923 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	92.77 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	240

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	1.450 Å
Low-resolution limit resolution_low	12.000 Å
R factor r_factor	0.1763
R_work r_work	0.1747
R_free r_free	0.2076

1.45 Angstrom Structure of STNV coat protein

1. Protein Identity and Related Structures Protein Identity & Related Structures

Coat protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4v4m__assembly_1__model_1

4v4m__assembly_1__model_1 | I(q)

4v4m__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

7. Citations (1)

1.45 Angstrom Structure of STNV coat protein

1. Protein Identity and Related Structures Protein Identity & Related Structures

Coat protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4v4m__assembly_1__model_1

4v4m__assembly_1__model_1 | I(q)

4v4m__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

7. Citations (1)