4v94

Molecular architecture of the eukaryotic chaperonin TRiC/CCT derived by a combination of chemical crosslinking and mass-spectrometry, XL-MS

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

T-complex protein 1 subunit zeta

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	T-complex protein 1 subunit theta × 2 （P47079） T-complex protein 1 subunit eta × 2 （P42943） T-complex protein 1 subunit epsilon × 2 （P40413） T-complex protein 1 subunit beta × 2 （P39076） T-complex protein 1 subunit delta × 2 （P39078） T-complex protein 1 subunit alpha × 2 （P12612） T-complex protein 1 subunit gamma × 2 （P39077） MAGNESIUM ION × 16 ADENOSINE-5'-DIPHOSPHATE × 16 BERYLLIUM TRIFLUORIDE ION × 16	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 16	T-complex protein 1 subunit theta × 2 （P47079） T-complex protein 1 subunit eta × 2 （P42943） T-complex protein 1 subunit epsilon × 2 （P40413） T-complex protein 1 subunit beta × 2 （P39076） T-complex protein 1 subunit delta × 2 （P39078） T-complex protein 1 subunit alpha × 2 （P12612） T-complex protein 1 subunit gamma × 2 （P39077） MAGNESIUM ION × 16 ADENOSINE-5'-DIPHOSPHATE × 16 BERYLLIUM TRIFLUORIDE ION × 16	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPZ_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain F； PDBConstruct 1–546； UniProt 1–546 Author chain N； PDBConstruct 1–546； UniProt 1–546 Author chain f； PDBConstruct 1–546； UniProt 1–546 Author chain n； PDBConstruct 1–546； UniProt 1–546

T-complex protein 1 subunit theta

Saccharomyces cerevisiae

UniProt P47079

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	T-complex protein 1 subunit zeta × 2 （P39079） T-complex protein 1 subunit eta × 2 （P42943） T-complex protein 1 subunit epsilon × 2 （P40413） T-complex protein 1 subunit beta × 2 （P39076） T-complex protein 1 subunit delta × 2 （P39078） T-complex protein 1 subunit alpha × 2 （P12612） T-complex protein 1 subunit gamma × 2 （P39077） MAGNESIUM ION × 16 ADENOSINE-5'-DIPHOSPHATE × 16 BERYLLIUM TRIFLUORIDE ION × 16	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 16	T-complex protein 1 subunit zeta × 2 （P39079） T-complex protein 1 subunit eta × 2 （P42943） T-complex protein 1 subunit epsilon × 2 （P40413） T-complex protein 1 subunit beta × 2 （P39076） T-complex protein 1 subunit delta × 2 （P39078） T-complex protein 1 subunit alpha × 2 （P12612） T-complex protein 1 subunit gamma × 2 （P39077） MAGNESIUM ION × 16 ADENOSINE-5'-DIPHOSPHATE × 16 BERYLLIUM TRIFLUORIDE ION × 16	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPQ_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain H； PDBConstruct 1–568； UniProt 1–568 Author chain P； PDBConstruct 1–568； UniProt 1–568 Author chain h； PDBConstruct 1–568； UniProt 1–568 Author chain p； PDBConstruct 1–568； UniProt 1–568

T-complex protein 1 subunit eta

Saccharomyces cerevisiae

UniProt P42943

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	T-complex protein 1 subunit zeta × 2 （P39079） T-complex protein 1 subunit theta × 2 （P47079） T-complex protein 1 subunit epsilon × 2 （P40413） T-complex protein 1 subunit beta × 2 （P39076） T-complex protein 1 subunit delta × 2 （P39078） T-complex protein 1 subunit alpha × 2 （P12612） T-complex protein 1 subunit gamma × 2 （P39077） MAGNESIUM ION × 16 ADENOSINE-5'-DIPHOSPHATE × 16 BERYLLIUM TRIFLUORIDE ION × 16	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 16	T-complex protein 1 subunit zeta × 2 （P39079） T-complex protein 1 subunit theta × 2 （P47079） T-complex protein 1 subunit epsilon × 2 （P40413） T-complex protein 1 subunit beta × 2 （P39076） T-complex protein 1 subunit delta × 2 （P39078） T-complex protein 1 subunit alpha × 2 （P12612） T-complex protein 1 subunit gamma × 2 （P39077） MAGNESIUM ION × 16 ADENOSINE-5'-DIPHOSPHATE × 16 BERYLLIUM TRIFLUORIDE ION × 16	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPH_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain G； PDBConstruct 1–550； UniProt 1–550 Author chain O； PDBConstruct 1–550； UniProt 1–550 Author chain g； PDBConstruct 1–550； UniProt 1–550 Author chain o； PDBConstruct 1–550； UniProt 1–550

T-complex protein 1 subunit epsilon

Saccharomyces cerevisiae

UniProt P40413

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	T-complex protein 1 subunit zeta × 2 （P39079） T-complex protein 1 subunit theta × 2 （P47079） T-complex protein 1 subunit eta × 2 （P42943） T-complex protein 1 subunit beta × 2 （P39076） T-complex protein 1 subunit delta × 2 （P39078） T-complex protein 1 subunit alpha × 2 （P12612） T-complex protein 1 subunit gamma × 2 （P39077） MAGNESIUM ION × 16 ADENOSINE-5'-DIPHOSPHATE × 16 BERYLLIUM TRIFLUORIDE ION × 16	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 16	T-complex protein 1 subunit zeta × 2 （P39079） T-complex protein 1 subunit theta × 2 （P47079） T-complex protein 1 subunit eta × 2 （P42943） T-complex protein 1 subunit beta × 2 （P39076） T-complex protein 1 subunit delta × 2 （P39078） T-complex protein 1 subunit alpha × 2 （P12612） T-complex protein 1 subunit gamma × 2 （P39077） MAGNESIUM ION × 16 ADENOSINE-5'-DIPHOSPHATE × 16 BERYLLIUM TRIFLUORIDE ION × 16	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPE_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 1–562； UniProt 1–562 Author chain M； PDBConstruct 1–562； UniProt 1–562 Author chain e； PDBConstruct 1–562； UniProt 1–562 Author chain m； PDBConstruct 1–562； UniProt 1–562

T-complex protein 1 subunit beta

Saccharomyces cerevisiae

UniProt P39076

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	T-complex protein 1 subunit zeta × 2 （P39079） T-complex protein 1 subunit theta × 2 （P47079） T-complex protein 1 subunit eta × 2 （P42943） T-complex protein 1 subunit epsilon × 2 （P40413） T-complex protein 1 subunit delta × 2 （P39078） T-complex protein 1 subunit alpha × 2 （P12612） T-complex protein 1 subunit gamma × 2 （P39077） MAGNESIUM ION × 16 ADENOSINE-5'-DIPHOSPHATE × 16 BERYLLIUM TRIFLUORIDE ION × 16	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 16	T-complex protein 1 subunit zeta × 2 （P39079） T-complex protein 1 subunit theta × 2 （P47079） T-complex protein 1 subunit eta × 2 （P42943） T-complex protein 1 subunit epsilon × 2 （P40413） T-complex protein 1 subunit delta × 2 （P39078） T-complex protein 1 subunit alpha × 2 （P12612） T-complex protein 1 subunit gamma × 2 （P39077） MAGNESIUM ION × 16 ADENOSINE-5'-DIPHOSPHATE × 16 BERYLLIUM TRIFLUORIDE ION × 16	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPB_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain B； PDBConstruct 1–527； UniProt 1–527 Author chain J； PDBConstruct 1–527； UniProt 1–527 Author chain b； PDBConstruct 1–527； UniProt 1–527 Author chain j； PDBConstruct 1–527； UniProt 1–527

T-complex protein 1 subunit delta

Saccharomyces cerevisiae

UniProt P39078

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	T-complex protein 1 subunit zeta × 2 （P39079） T-complex protein 1 subunit theta × 2 （P47079） T-complex protein 1 subunit eta × 2 （P42943） T-complex protein 1 subunit epsilon × 2 （P40413） T-complex protein 1 subunit beta × 2 （P39076） T-complex protein 1 subunit alpha × 2 （P12612） T-complex protein 1 subunit gamma × 2 （P39077） MAGNESIUM ION × 16 ADENOSINE-5'-DIPHOSPHATE × 16 BERYLLIUM TRIFLUORIDE ION × 16	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 16	T-complex protein 1 subunit zeta × 2 （P39079） T-complex protein 1 subunit theta × 2 （P47079） T-complex protein 1 subunit eta × 2 （P42943） T-complex protein 1 subunit epsilon × 2 （P40413） T-complex protein 1 subunit beta × 2 （P39076） T-complex protein 1 subunit alpha × 2 （P12612） T-complex protein 1 subunit gamma × 2 （P39077） MAGNESIUM ION × 16 ADENOSINE-5'-DIPHOSPHATE × 16 BERYLLIUM TRIFLUORIDE ION × 16	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPD_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain D； PDBConstruct 1–528； UniProt 1–528 Author chain L； PDBConstruct 1–528； UniProt 1–528 Author chain d； PDBConstruct 1–528； UniProt 1–528 Author chain l； PDBConstruct 1–528； UniProt 1–528

T-complex protein 1 subunit alpha

Saccharomyces cerevisiae

UniProt P12612

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	T-complex protein 1 subunit zeta × 2 （P39079） T-complex protein 1 subunit theta × 2 （P47079） T-complex protein 1 subunit eta × 2 （P42943） T-complex protein 1 subunit epsilon × 2 （P40413） T-complex protein 1 subunit beta × 2 （P39076） T-complex protein 1 subunit delta × 2 （P39078） T-complex protein 1 subunit gamma × 2 （P39077） MAGNESIUM ION × 16 ADENOSINE-5'-DIPHOSPHATE × 16 BERYLLIUM TRIFLUORIDE ION × 16	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 16	T-complex protein 1 subunit zeta × 2 （P39079） T-complex protein 1 subunit theta × 2 （P47079） T-complex protein 1 subunit eta × 2 （P42943） T-complex protein 1 subunit epsilon × 2 （P40413） T-complex protein 1 subunit beta × 2 （P39076） T-complex protein 1 subunit delta × 2 （P39078） T-complex protein 1 subunit gamma × 2 （P39077） MAGNESIUM ION × 16 ADENOSINE-5'-DIPHOSPHATE × 16 BERYLLIUM TRIFLUORIDE ION × 16	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPA_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain A； PDBConstruct 1–559； UniProt 1–559 Author chain I； PDBConstruct 1–559； UniProt 1–559 Author chain a； PDBConstruct 1–559； UniProt 1–559 Author chain i； PDBConstruct 1–559； UniProt 1–559

T-complex protein 1 subunit gamma

Saccharomyces cerevisiae

UniProt P39077

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	T-complex protein 1 subunit zeta × 2 （P39079） T-complex protein 1 subunit theta × 2 （P47079） T-complex protein 1 subunit eta × 2 （P42943） T-complex protein 1 subunit epsilon × 2 （P40413） T-complex protein 1 subunit beta × 2 （P39076） T-complex protein 1 subunit delta × 2 （P39078） T-complex protein 1 subunit alpha × 2 （P12612） MAGNESIUM ION × 16 ADENOSINE-5'-DIPHOSPHATE × 16 BERYLLIUM TRIFLUORIDE ION × 16	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 16	T-complex protein 1 subunit zeta × 2 （P39079） T-complex protein 1 subunit theta × 2 （P47079） T-complex protein 1 subunit eta × 2 （P42943） T-complex protein 1 subunit epsilon × 2 （P40413） T-complex protein 1 subunit beta × 2 （P39076） T-complex protein 1 subunit delta × 2 （P39078） T-complex protein 1 subunit alpha × 2 （P12612） MAGNESIUM ION × 16 ADENOSINE-5'-DIPHOSPHATE × 16 BERYLLIUM TRIFLUORIDE ION × 16	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPG_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain C； PDBConstruct 1–374； UniProt 1–374 Author chain C； PDBConstruct 431–590； UniProt 375–534 Author chain K； PDBConstruct 1–374； UniProt 1–374 Author chain K； PDBConstruct 431–590； UniProt 375–534 Author chain c； PDBConstruct 1–374； UniProt 1–374 Author chain c； PDBConstruct 431–590； UniProt 375–534 Author chain k； PDBConstruct 1–374； UniProt 1–374 Author chain k； PDBConstruct 431–590； UniProt 375–534

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4v94
Deposition date deposition_date	2012-01-11
Structure title title	Molecular architecture of the eukaryotic chaperonin TRiC/CCT derived by a combination of chemical crosslinking and mass-spectrometry, XL-MS
Keywords keywords	chaperonin, nano cage, protein folding, molecular chaperone, ATPase, cytosol, CHAPERONE; CHAPERONE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4v94__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4v94__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4v94__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	65.57 Å
Rg (electron density)	64.44 Å
Total Rg	64.50 Å
Atom count	60040
Residues	8426
Excluded volume	1066400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4v94__assembly_1__model_1`	hexadecameric （16）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4v94__assembly_2__model_1`	hexadecameric （16）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (11)

Entity 1 Entity 1 polymer

Description description	T-complex protein 1 subunit zeta
Molecular weight formula_weight	59997.6 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,N,f,n
Atom count atom_count	120080

MSLQLLNPKAESLRRDAALKVNVTSAEGLQSVLETNLGPKGTLKMLVDGAGNIKLTKDGKVLLTEMQIQSPTAVLIARAAAAQDEITGDGTTTVVCLVGELLRQAHRFIQEGVHPRIITDGFEIARKESMKFLDEFKISKTNLSNDREFLLQVARSSLLTKVDADLTEVLTPIVTDAVLSVYDAQADNLDLHMVEIMQMQHLSPKDTTFIKGLVLDHGGRHPDMPTRVKNAYVLILNVSLEYEKTEVNSGFFYSSADQRDKLAASERKFVDAKLKKIIDLKNEVCGMDPDKGFVIINQKGIDPMSLDVFAKHNILALRRAKRRNMERLQLVTGGEAQNSVEDLSPQILGFSGLVYQETIGEEKFTYVTENTDPKSCTILIKGSTHYALAQTKDAVRDGLRAVANVLKDKNIIPGAGAFYIALSRYLRSANMNKLGAKGKTKTGIEAFAEALLVIPKTLVKNSGFDPLDVLAMVEDELDDAQDSDETRYVGVDLNIGDSCDPTIEGIWDSYRVLRNAITGATGIASNLLLCDELLRAGRSTLKETPQ

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	SACCHAROMYCES CEREVISIAE

Entity 2 Entity 2 polymer

Description description	T-complex protein 1 subunit theta
Molecular weight formula_weight	61735.1 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,P,h,p

MSLRLPQNPNAGLFKQGYNSYSNADGQIIKSIAAIRELHQMCLTSMGPCGRNKIIVNHLGKIIITNDAATMLRELDIVHPAVKVLVMATEQQKIDMGDGTNLVMILAGELLNVSEKLISMGLSAVEIIQGYNMARKFTLKELDEMVVGEITDKNDKNELLKMIKPVISSKKYGSEDILSELVSEAVSHVLPVAQQAGEIPYFNVDSIRVVKIMGGSLSNSTVIKGMVFNREPEGHVKSLSEDKKHKVAVFTCPLDIANTETKGTVLLHNAQEMLDFSKGEEKQIDAMMKEIADMGVECIVAGAGVGELALHYLNRYGILVLKVPSKFELRRLCRVCGATPLPRLGAPTPEELGLVETVKTMEIGGDRVTVFKQEQGEISRTSTIILRGATQNNLDDIERAIDDGVAAVKGLMKPSGGKLLPGAGATEIELISRITKYGERTPGLLQLAIKQFAVAFEVVPRTLAETAGLDVNEVLPNLYAAHNVTEPGAVKTDHLYKGVDIDGESDEGVKDIREENIYDMLATKKFAINVATEAATTVLSIDQIIMAKKAGGPRAPQGPRPGNWDQED

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	SACCHAROMYCES CEREVISIAE

Entity 3 Entity 3 polymer

Description description	T-complex protein 1 subunit eta
Molecular weight formula_weight	59802.4 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,O,g,o

MNFGSQTPTIVVLKEGTDASQGKGQIISNINACVAVQEALKPTLGPLGSDILIVTSNQKTTISNDGATILKLLDVVHPAAKTLVDISRAQDAEVGDGTTSVTILAGELMKEAKPFLEEGISSHLIMKGYRKAVSLAVEKINELAVDITSEKSSGRELLERCARTAMSSKLIHNNADFFVKMCVDAVLSLDRNDLDDKLIGIKKIPGGAMEESLFINGVAFKKTFSYAGFEQQPKKFNNPKILSLNVELELKAEKDNAEVRVEHVEDYQAIVDAEWQLIFEKLRQVEETGANIVLSKLPIGDLATQFFADRNIFCAGRVSADDMNRVIQAVGGSIQSTTSDIKPEHLGTCALFEEMQIGSERYNLFQGCPQAKTCTLLLRGGAEQVIAEVERSLHDAIMIVKRALQNKLIVAGGGATEMEVSKCLRDYSKTIAGKQQMIINAFAKALEVIPRQLCENAGFDAIEILNKLRLAHSKGEKWYGVVFETENIGDNFAKFVWEPALVKINALNSATEATNLILSVDETITNKGSESANAGMMPPQGAGRGRGMPM

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	SACCHAROMYCES CEREVISIAE

Entity 4 Entity 4 polymer

Description description	T-complex protein 1 subunit epsilon
Molecular weight formula_weight	61995.0 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,M,e,m

MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSHILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEIAKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGFDEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRFAEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFSHPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQTYEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQELEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKETKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTMSLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKSKQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILKIDNVIISGKDEY

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	SACCHAROMYCES CEREVISIAE

Entity 5 Entity 5 polymer

Description description	T-complex protein 1 subunit beta
Molecular weight formula_weight	57276.3 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,J,b,j

MSVQIFGDQVTEERAENARLSAFVGAIAVGDLVKSTLGPKGMDKLLQSASSNTCMVTNDGATILKSIPLDNPAAKVLVNISKVQDDEVGDGTTSVTVLSAELLREAEKLIDQSKIHPQTIIEGYRLASAAALDALTKAAVDNSHDKTMFREDLIHIAKTTLSSKILSQDKDHFAELATNAILRLKGSTNLEHIQIIKILGGKLSDSFLDEGFILAKKFGNNQPKRIENAKILIANTTLDTDKVKIFGTKFKVDSTAKLAQLEKAEREKMKNKIAKISKFGINTFINRQLIYDYPEQLFTDLGINSIEHADFEGVERLALVTGGEVVSTFDEPSKCKLGECDVIEEIMLGEQPFLKFSGCKAGEACTIVLRGATDQTLDEAERSLHDALSVLSQTTKETRTVLGGGCAEMVMSKAVDTEAQNIDGKKSLAVEAFARALRQLPTILADNAGFDSSELVSKLRSSIYNGISTSGLDLNNGTIADMRQLGIVESYKLKRAVVSSASEAAEVLLRVDNIIRARPRTANRQHM

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	SACCHAROMYCES CEREVISIAE

Entity 6 Entity 6 polymer

Description description	T-complex protein 1 subunit delta
Molecular weight formula_weight	57740.4 kDa
Mutation mutation	G345D
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,L,d,l

MSAKVPSNATFKNKEKPQEVRKANIIAARSVADAIRTSLGPKGMDKMIKTSRGEIIISNDGHTILKQMAILHPVARMLVEVSAAQDSEAGDGTTSVVILTGALLGAAERLLNKGIHPTIIADSFQSAAKRSVDILLEMCHKVSLSDREQLVRAASTSLSSKIVSQYSSFLAPLAVDSVLKISDENSKNVDLNDIRLVKKVGGTIDDTEMIDGVVLTQTAIKSAGGPTRKEKAKIGLIQFQISPPKPDTENNIIVNDYRQMDKILKEERAYLLNICKKIKKAKCNVLLIQKSILRDAVNDLALHFLSKLNIMVVKDIEREEIEFLSKGLGCKPIADIELFTEDRLDSADLVEEIDSDGSKIVRVTGIRNNNARPTVSVVIRGANNMIIDETERSLHDALCVIRCLVKERGLIAGGGAPEIEISRRLSKEARSMEGVQAFIWQEFASALEVIPTTLAENAGLNSIKVVTELRSKHENGELNDGISVRRSGTTNTYEEHILQPVLVSTSAITLASECVKSILRIDDIAFSR

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	SACCHAROMYCES CEREVISIAE

Entity 7 Entity 7 polymer

Description description	T-complex protein 1 subunit alpha
Molecular weight formula_weight	60557.6 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,I,a,i

MSQLFNNSRSDTLFLGGEKISGDDIRNQNVLATMAVANVVKSSLGPVGLDKMLVDDIGDFTVTNDGATILSLLDVQHPAGKILVELAQQQDREIGDGTTSVVIIASELLKRANELVKNKIHPTTIITGFRVALREAIRFINEVLSTSVDTLGKETLINIAKTSMSSKIIGADSDFFSNMVVDALLAVKTQNSKGEIKYPVKAVNVLKAHGKSATESLLVPGYALNCTVASQAMPKRIAGGNVKIACLDLNLQKARMAMGVQINIDDPEQLEQIRKREAGIVLERVKKIIDAGAQVVLTTKGIDDLCLKEFVEAKIMGVRRCKKEDLRRIARATGATLVSSMSNLEGEETFESSYLGLCDEVVQAKFSDDECILIKGTSKHSSSSIILRGANDYSLDEMERSLHDSLSVVKRTLESGNVVPGGGCVEAALNIYLDNFATTVGSREQLAIAEFAAALLIIPKTLAVNAAKDSSELVAKLRSYHAASQMAKPEDVKRRSYRNYGLDLIRGKIVDEIHAGVLEPTISKVKSLKSALEACVAILRIDTMITVDPEPPKEDPHDH

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	SACCHAROMYCES CEREVISIAE

Entity 8 Entity 8 polymer

Description description	T-complex protein 1 subunit gamma
Molecular weight formula_weight	64939.8 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,K,c,k

MQAPVVFMNASQERTTGRQAQISNITAAKAVADVIRTCLGPKAMLKMLLDPMGGLVLTNDGHAILREIDVAHPAAKSMLELSRTQDEEVGDGTTTVIILAGEILAQCAPYLIEKNIHPVIIIQALKKALTDALEVIKQVSKPVDVENDAAMKKLIQASIGTKYVIHWSEKMCELALDAVKTVRKDLGQTVEGEPNFEIDIKRYVRVEKIPGGDVLDSRVLKGVLLNKDVVHPKMSRHIENPRVVLLDCPLEYKKGESQTNIEIEKEEDWNRILQIEEEQVQLMCEQILAVRPTLVITEKGVSDLAQHYLLKGGCSVLRRVKKSDNNRIARVTGATIVNRVEDLKESDVGTNCGLFKVEMIGDEYFSFLDNCKEPGSGSGWSHPQFEKGSGKRRWKKNFIAVSAANRFKKISSSGALGSGHHHHHHHHGSGKACTIMLRGGSKDILNEIDRNLQDAMAVARNVMLSPSLSPGGGATEMAVSVKLAEKAKQLEGIQQWPYQAVADAMECIPRTLIQNAGGDPIRLLSQLRAKHAQGNFTTGIDGDKGKIVDMVSYGIWEPEVIKQQSVKTAIESACLLLRVDDIVSGVRKQE

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	SACCHAROMYCES CEREVISIAE

Entity 9 Entity 9 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	32

Entity 10 Entity 10 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	32

Entity 11 Entity 11 non-polymer

Description description	BERYLLIUM TRIFLUORIDE ION
Molecular weight formula_weight	66.0 kDa
Source method src_method	syn
Copy count entity_count	32

▶

Unit-cell length a length_a	159.100 Å
Unit-cell length b length_b	162.540 Å
Unit-cell length c length_c	268.100 Å
Unit-cell angle α angle_alpha	85.23 °
Unit-cell angle β angle_beta	81.15 °
Unit-cell angle γ angle_gamma	61.17 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.800 Å
Low-resolution limit resolution_low	30.000 Å
R factor r_factor	0.2592
R_work r_work	0.2568
R_free r_free	0.3046

Molecular architecture of the eukaryotic chaperonin TRiC/CCT derived by a combination of chemical crosslinking and mass-spectrometry, XL-MS

1. Protein Identity and Related Structures Protein Identity & Related Structures

T-complex protein 1 subunit zeta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

T-complex protein 1 subunit theta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

T-complex protein 1 subunit eta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

T-complex protein 1 subunit epsilon

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

T-complex protein 1 subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

T-complex protein 1 subunit delta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

T-complex protein 1 subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

T-complex protein 1 subunit gamma

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4v94__assembly_2__model_1

4v94__assembly_2__model_1 | I(q)

4v94__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (11)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer