SAXSdb — 4wnl

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

SWI5-dependent HO expression protein 2

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	SWI5-dependent HO expression protein 3 × 2 （B5VE90） GLYCEROL × 2 SULFATE ION × 2 ISOPROPYL ALCOHOL × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	SWI5-dependent HO expression protein 3 × 2 （B5VE90） GLYCEROL × 4 SULFATE ION × 2 ISOPROPYL ALCOHOL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SHE2_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–234； UniProt 6–239 Author chain B； PDBConstruct 1–234； UniProt 6–239 Author chain C； PDBConstruct 1–234； UniProt 6–239 Author chain D； PDBConstruct 1–234； UniProt 6–239

SWI5-dependent HO expression protein 3

OrganismNot specified

UniProt B5VE90

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	SWI5-dependent HO expression protein 2 × 2 （P36068） GLYCEROL × 2 SULFATE ION × 2 ISOPROPYL ALCOHOL × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	SWI5-dependent HO expression protein 2 × 2 （P36068） GLYCEROL × 4 SULFATE ION × 2 ISOPROPYL ALCOHOL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SHE3_YEAS6
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 1–33； UniProt 342–374 Author chain F； PDBConstruct 1–33； UniProt 342–374 Author chain G； PDBConstruct 1–33； UniProt 342–374 Author chain H； PDBConstruct 1–33； UniProt 342–374

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4wnl
Deposition date deposition_date	2014-10-13
Structure title title	The X-ray structure of a RNA-binding protein complex
Keywords keywords	RNA-binding, mRNA transport, RNA BINDING PROTEIN; RNA BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4wnl__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4wnl__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4wnl__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	30.16 Å
Rg (electron density)	29.29 Å
Total Rg	30.05 Å
Atom count	3719
Residues	456
Excluded volume	67002 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4wnl__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4wnl__assembly_2__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	SWI5-dependent HO expression protein 2
Molecular weight formula_weight	26721.2 kDa
Mutation mutation	C14S, C68S, C180S
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,A,B,D
Atom count atom_count	7576

DIKVTPGTSELVEQILALLSRYLSSYIHVLNKFISHLRRVATLRFERTTLIKFVKKLRFYNDSVLSYNASEFINEGKNELDPGADSFDKVILPIASMFVKCVETFDLLNYYLTQSLQKEILSKTLNEDLTLTAESILAIDDTYNHFVKFSQWMIESLRIGSNLLDLEVVQFAIKSADEDGTNIGETDNIFLQEILPVNSEEEFQTLSAAWHSILDGKLGALDEEFDVVATKWHD

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	SWI5-dependent HO expression protein 3
Molecular weight formula_weight	3423.0 kDa
Source method src_method	syn
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,G,H

RSFYTASPLLSSGSIPKSASPVLPGVKRTASVR

Entity 3 Entity 3 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 4 Entity 4 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 5 Entity 5 non-polymer

Description description	ISOPROPYL ALCOHOL
Molecular weight formula_weight	60.1 kDa
Source method src_method	syn
Copy count entity_count	2

▼

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	4wnlA00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	200 — Fumarase C; Chain A, domain 2
Homologous superfamily homologous superfamily	20 — She2 domain

Domain ID domain_id	4wnlB00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	200 — Fumarase C; Chain A, domain 2
Homologous superfamily homologous superfamily	20 — She2 domain

Domain ID domain_id	4wnlC00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	200 — Fumarase C; Chain A, domain 2
Homologous superfamily homologous superfamily	20 — She2 domain

Domain ID domain_id	4wnlD00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	200 — Fumarase C; Chain A, domain 2
Homologous superfamily homologous superfamily	20 — She2 domain

▶

Unit-cell length a length_a	175.620 Å
Unit-cell length b length_b	64.670 Å
Unit-cell length c length_c	116.370 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	117.94 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	2.800 Å
Low-resolution limit resolution_low	59.692 Å
R factor r_factor	0.2143
R_work r_work	0.2123
R_free r_free	0.2543

The X-ray structure of a RNA-binding protein complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

SWI5-dependent HO expression protein 2

State in the Current Structure

Other States of the Same Protein in the Database

SWI5-dependent HO expression protein 3

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4wnl__assembly_2__model_1

4wnl__assembly_2__model_1 | I(q)

4wnl__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)

The X-ray structure of a RNA-binding protein complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

SWI5-dependent HO expression protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

SWI5-dependent HO expression protein 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4wnl__assembly_2__model_1

4wnl__assembly_2__model_1 | I(q)

4wnl__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)